PDB entry 6jda

View 6jda on RCSB PDB site
Description: crystal structure of n-acetyl mannosmaine kinase in complex with n- acetylmannosamine in pasteurella multocida
Deposited on 2019-01-31, released 2020-02-05
The last revision was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylmannosamine kinase
    Species: PASTEURELLA MULTOCIDA [TaxId:747]
    Gene: nanK
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BM3, ZN, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jdaA (A:)
mrclaldiggtkiasaivtdgkieqrqqiatpqadaanamhdtlanilalyagqfdyvav
astgiinhgvltalnpknlgglaefplkesiarhtdkpigllndvqaaacaeykdedkna
vqnfvfitvstgvgggiilerrlltepngvaghightladpngpvcgcgrvgcveavaag
raieavssqwnppctpkqafelfrkndekataliqrsasaianliadlvigldvqkvvvg
gsvglaegylplvkqylntmphfyhctveqarhgqdagllgaawwvadclk