PDB entry 6jco

View 6jco on RCSB PDB site
Description: Crystal structure of calcium free human gelsolin amyloid mutant D187N
Class: Actin Binding Protein
Keywords: gelsolin, amyloidosis, calcium activation, Actin Binding Protein
Deposited on 2019-01-29, released 2019-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jcoA (A:)
    hpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhyw
    lgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvasg
    fkhvvpnevvvqrlfqvkgrrvvratevpvswesfnngncfildlgnnihqwcgsnsnry
    erlkatqvskgirdnersgrarvhvseegtepeamlqvlgpkpalpagtedtakedaanr
    klaklykvsngagtmsvslvadenpfaqgalksedcfildhgkdgkifvwkgkqanteer
    kaalktasdfitkmdypkqtqvsvlpeggetplfkqffknwrdpdqtdglglsylsshia
    nvervpfdaatlhtstamaaqhgmdddgtgqkqiwriegsnkvpvdpatygqfyggdsyi
    ilynyrhggrqgqiiynwqgaqstqdevaasailtaqldeelggtpvqsrvvqgkepahl
    mslfggkpmiiykggtsreggqtapastrlfqvransagatravevlpkagalnsndafv
    lktpsaaylwvgtgaseaektgaqellrvlraqpvqvaegsepdgfwealggkaayrtsp
    rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds
    qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddywsvdpldr
    amaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jcoA (A:)
    kepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhywlgnecsqd
    esgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvasgfkhvvvqr
    lfqvkgrrvvratevpvswesfnngncfildlgnnihqwcgsnsnryerlkatqvskgir
    dnersgrarvhvseegtepeamlqvlgpkpalpadaanrklaklykvsnggtmsvslvad
    enpfaqgalksedcfildhgkdgkifvwkgkqanteerkaalktasdfitkmdypkqtqv
    svlpeggetplfkqffknwrdpdqtdglglsylsshianvervpfdaatlhtstamaaqh
    gmdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaq
    stqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsregqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnrfvi
    eevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanrdrr
    tpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jcoB (B:)
    hpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhyw
    lgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvasg
    fkhvvpnevvvqrlfqvkgrrvvratevpvswesfnngncfildlgnnihqwcgsnsnry
    erlkatqvskgirdnersgrarvhvseegtepeamlqvlgpkpalpagtedtakedaanr
    klaklykvsngagtmsvslvadenpfaqgalksedcfildhgkdgkifvwkgkqanteer
    kaalktasdfitkmdypkqtqvsvlpeggetplfkqffknwrdpdqtdglglsylsshia
    nvervpfdaatlhtstamaaqhgmdddgtgqkqiwriegsnkvpvdpatygqfyggdsyi
    ilynyrhggrqgqiiynwqgaqstqdevaasailtaqldeelggtpvqsrvvqgkepahl
    mslfggkpmiiykggtsreggqtapastrlfqvransagatravevlpkagalnsndafv
    lktpsaaylwvgtgaseaektgaqellrvlraqpvqvaegsepdgfwealggkaayrtsp
    rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds
    qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddywsvdpldr
    amaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jcoB (B:)
    hpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhyw
    lgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvasg
    fkhvvevvvqrlfqvkgrrvvratevpvswesfnngncfildlgnnihqwcgsnsnryer
    lkatqvskgirdnersgrarvhvseegtepeamlqvlgpkpalpagtedaanrklaklyk
    vsngatmsvslvadenpfaqgalksedcfildhgkdgkifvwkgkqanteerkaalktas
    dfitkmdypkqtqvsvlpeggetplfkqffknwrdpdglglsylsshianvervpfdaat
    lhtstamaaqhgmdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrq
    gqiiynwqgaqstqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmii
    ykggtsreggqtapastrlfqvransagatravevlpkagalnsndafvlktpsaaylwv
    gtgaseaektgaqellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahp
    prlfacsnigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsa
    kryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa