PDB entry 6jcf

View 6jcf on RCSB PDB site
Description: Cryogenic structure of HIV-1 Integrase catalytic core domain by synchrotron
Class: viral protein
Keywords: HIV, HIV-1, Integrase, cryogenic, VIRAL PROTEIN
Deposited on 2019-01-28, released 2019-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2WR52
      • engineered mutation (135)
    Domains in SCOPe 2.08: d6jcfa_
  • Heterogens: CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jcfA (A:)
    ghgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp
    vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa
    ehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jcfA (A:)
    cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
    dngsnftsttvkaacwwagikqefgqgviesmnkelkkiigqvrdqaehlktavqmavfi
    hnkkrkysagerivdiiatdiq