PDB entry 6jcc

View 6jcc on RCSB PDB site
Description: structure of a de novo protein d_1cy5_m1
Deposited on 2019-01-28, released 2019-03-13
The last revision was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Computational designed protein based on evolution
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JCC (0-96)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jccA (A:)
hhhmtpeqreflleilaeiianldptkileeplrrglltpaelqevldlktpeeqakkli
dfilklspaeaqalidalrahgyqaladklkkylple