PDB entry 6jbz

View 6jbz on RCSB PDB site
Description: Structural analysis of molybdopterin synthases from two mycobacteria pathogens
Class: transferase
Keywords: molybdopterin synthases, molybdenum cofactor biosynthesis, sulfur transfer, TRANSFERASE
Deposited on 2019-01-27, released 2019-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Molybdenum cofactor biosynthesis protein E
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: moaE2, DSI35_12490, ERS007665_01777, ERS023446_04125, ERS027644_03382, ERS027646_04529, ERS027651_03265, ERS027654_03076, ERS027656_02816, ERS027659_04568, ERS031537_04564, ERS124361_04403, SAMEA2682864_02201, SAMEA2683035_02189
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A045HUW8 (0-140)
  Domains in SCOPe 2.08: d6jbza_
• Chain 'B':
  Compound: MoaD/ThiS family protein
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: moaD2, DSI35_02305, ERS007661_02601, ERS007663_03167, ERS007665_02512, ERS007672_04797, ERS007679_03857, ERS007688_03620, ERS007703_04370, ERS007720_02994, ERS007722_03637, ERS007726_00134, ERS007739_02763, ERS007741_03204, ERS023446_04078, ERS024213_03738, ERS024276_02321, ERS027644_02085, ERS027646_03803, ERS027651_01514, ERS027652_02678, ERS027653_03930, ERS027654_04370, ERS027659_02621, ERS027661_03197, ERS027666_05139, ERS031537_04168, ERS124361_05937, SAMEA2682864_02198, SAMEA2683035_02192
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A045H6C3 (Start-91)
• Chain 'C':
  Compound: Molybdenum cofactor biosynthesis protein E
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: moaE2, DSI35_12490, ERS007665_01777, ERS023446_04125, ERS027644_03382, ERS027646_04529, ERS027651_03265, ERS027654_03076, ERS027656_02816, ERS027659_04568, ERS031537_04564, ERS124361_04403, SAMEA2682864_02201, SAMEA2683035_02189
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A045HUW8 (0-140)
  Domains in SCOPe 2.08: d6jbzc_
• Chain 'D':
  Compound: MoaD/ThiS family protein
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: moaD2, DSI35_02305, ERS007661_02601, ERS007663_03167, ERS007665_02512, ERS007672_04797, ERS007679_03857, ERS007688_03620, ERS007703_04370, ERS007720_02994, ERS007722_03637, ERS007726_00134, ERS007739_02763, ERS007741_03204, ERS023446_04078, ERS024213_03738, ERS024276_02321, ERS027644_02085, ERS027646_03803, ERS027651_01514, ERS027652_02678, ERS027653_03930, ERS027654_04370, ERS027659_02621, ERS027661_03197, ERS027666_05139, ERS031537_04168, ERS124361_05937, SAMEA2682864_02198, SAMEA2683035_02192
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A045H6C3 (Start-91)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jbzA (A:)
  mtqvlraaltdqpiflaeheelvshrsagaivgfvgmirdrdggrgvlrleysahpsaaq
  vladlvaevaeessgvravaashrigvlqvgeaalvaavaadhrraafgtcahlvetika
  rlpvwkhqffedgtdewvgsv
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jbzC (C:)
  mtqvlraaltdqpiflaeheelvshrsagaivgfvgmirdrdggrgvlrleysahpsaaq
  vladlvaevaeessgvravaashrigvlqvgeaalvaavaadhrraafgtcahlvetika
  rlpvwkhqffedgtdewvgsv
  

  
  
• Chain 'D':
  No sequence available.