PDB entry 6jbw

View 6jbw on RCSB PDB site
Description: Structure of Tps1/UDP complex
Class: transferase
Keywords: Trehalose-6-phosphate synthase, TRANSFERASE
Deposited on 2019-01-26, released 2019-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trehalose-6-phosphate synthase
    Species: Pyricularia oryzae 70-15 [TaxId:242507]
    Gene: MGG_03860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jbwa_
  • Chain 'B':
    Compound: Trehalose-6-phosphate synthase
    Species: Pyricularia oryzae 70-15 [TaxId:242507]
    Gene: MGG_03860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jbwb_
  • Heterogens: UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jbwA (A:)
    rlllisnrlpitikrsddgqysfsmssgglvtglsglakttsfqwygwpglevpdaeagp
    vvqrlkneygahpvfvddeladrhyngfansilwplfhyhpgeitfdesawsaykevnrl
    faqtvvkdvqdgdmiwvhdyhlmllpemlreeigdskknvkigfflhtpfpsseiyrilp
    vrqallqgvlhcdllgfhtydyarhflsscsrilsapttpngvqfagrfvtvgafpigid
    pekfveglqkpkvqqriaaltrkfegvklivgvdrldyikgvpqklhalevfltehpewi
    gkivlvqvavpsrqdveeyqnlravvnelvgringkfgtiefmpihflhqsvsfdelaal
    yavsdvclvsstrdgmnlvsyeyiatqrdrhgvmilseftgaaqslsgslivnpwnteel
    anaihdavtmgpeqreanfkkleryvfkytsawwgssfvaelnrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jbwA (A:)
    rlllisnrlpitikrsmssgglvtglsglakttsfqwygwpglevpdaeagpvvqrlkne
    ygahpvfvddeladrhyngfansilwplfhyhpgeitfdesawsaykevnrlfaqtvvkd
    vqdgdmiwvhdyhlmllpemlreeigdskknvkigfflhtpfpsseiyrilpvrqallqg
    vlhcdllgfhtydyarhflsscsrilsapttpngvqfagrfvtvgafpigidpekfvegl
    qkpkvqqriaaltrkfegvklivgvdrldyikgvpqklhalevfltehpewigkivlvqv
    avpsrqdveeyqnlravvnelvgringkfgtiefmpihflhqsvsfdelaalyavsdvcl
    vsstrdgmnlvsyeyiatqrdrhgvmilseftgaaqslsgslivnpwnteelanaihdav
    tmgpeqreanfkkleryvfkytsawwgssfvaelnrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jbwB (B:)
    rlllisnrlpitikrsddgqysfsmssgglvtglsglakttsfqwygwpglevpdaeagp
    vvqrlkneygahpvfvddeladrhyngfansilwplfhyhpgeitfdesawsaykevnrl
    faqtvvkdvqdgdmiwvhdyhlmllpemlreeigdskknvkigfflhtpfpsseiyrilp
    vrqallqgvlhcdllgfhtydyarhflsscsrilsapttpngvqfagrfvtvgafpigid
    pekfveglqkpkvqqriaaltrkfegvklivgvdrldyikgvpqklhalevfltehpewi
    gkivlvqvavpsrqdveeyqnlravvnelvgringkfgtiefmpihflhqsvsfdelaal
    yavsdvclvsstrdgmnlvsyeyiatqrdrhgvmilseftgaaqslsgslivnpwnteel
    anaihdavtmgpeqreanfkkleryvfkytsawwgssfvaelnrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jbwB (B:)
    rlllisnrlpitikrsmssgglvtglsglakttsfqwygwpglevpdaeagpvvqrlkne
    ygahpvfvddeladrhyngfansilwplfhyhpgeitfdesawsaykevnrlfaqtvvkd
    vqdgdmiwvhdyhlmllpemlreeigdskknvkigfflhtpfpsseiyrilpvrqallqg
    vlhcdllgfhtydyarhflsscsrilsapttpngvqfagrfvtvgafpigidpekfvegl
    qkpkvqqriaaltrkfegvklivgvdrldyikgvpqklhalevfltehpewigkivlvqv
    avpsrqdveeyqnlravvnelvgringkfgtiefmpihflhqsvsfdelaalyavsdvcl
    vsstrdgmnlvsyeyiatqrdrhgvmilseftgaaqslsgslivnpwnteelanaihdav
    tmgpeqreanfkkleryvfkytsawwgssfvaelnrl