PDB entry 6jbp

View 6jbp on RCSB PDB site
Description: Structure of MP-4 from Mucuna pruriens at 2.22 Angstroms
Class: plant protein
Keywords: Protease Inhibitor, Mucuna pruriens, PLANT PROTEIN
Deposited on 2019-01-26, released 2020-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Kunitz-type trypsin inhibitor-like 2 protein
    Species: Mucuna pruriens [TaxId:157652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jbpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6jbpB (B:)
aepvidtdgnplhrggkyyimpsiwgppggglrlgktenlncpvtvlqdysevinglpve
fnirgilprtiftdtelnieftekpncaensrwslfeddkihkayvgigdsedhpdqeml
sgsfyikkhglrnntyklvfcrdgsstcsdigrydnnedgrrliltadlpyevvfvnas