PDB entry 6jbh

View 6jbh on RCSB PDB site
Description: cryo-em structure and transport mechanism of a wall teichoic acid abc transporter
Deposited on 2019-01-25, released 2020-03-04
The last revision was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: EM
Resolution: 3.94 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TarH
    Species: Alicyclobacillus herbarius [TaxId:122960]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JBH
  • Chain 'B':
    Compound: TarH
    Species: Alicyclobacillus herbarius [TaxId:122960]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JBH
  • Chain 'C':
    Compound: TarG
    Species: Alicyclobacillus herbarius [TaxId:122960]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JBH
  • Chain 'D':
    Compound: TarG
    Species: Alicyclobacillus herbarius [TaxId:122960]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JBH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jbhA (A:)
    mehavivenvtkkyklfkrtserlldmilpggygedfyalrnvsftadkgdvigivgvng
    sgkstlsniiagilpptsgtikidgqasliaissglnnqltgrenielkclmlgfskkqi
    ramepdiiefadigkfidqpvktyssgmksrlgfaisvnidpdvlvidealsvgdqtfad
    kcldkmnefkergktiffishsigqvksfcekalwleygevrgygtvaeiipqyekflke
    yramsdkekrqykervmrkqqgeflqaavk
    

    Sequence, based on observed residues (ATOM records):
    >6jbhA (A:)
    ehavivenvtkkyklfkrtserlldmilpggygedfyalrnvsftadkgdvigivgvngs
    gkstlsniiagilpptsgtikidgqasliaissglnnqltgrenielkclmlgfskkqir
    amepdiiefadigkfidqpvktyssgmksrlgfaisvnidpdvlvidealsvgdqtfadk
    cldkmnefkergktiffishsigqvksfcekalwleygevrgygtvaeiipqyekflkey
    ramsdkekrqykervmrkqqgefl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6jbhB (B:)
    mehavivenvtkkyklfkrtserlldmilpggygedfyalrnvsftadkgdvigivgvng
    sgkstlsniiagilpptsgtikidgqasliaissglnnqltgrenielkclmlgfskkqi
    ramepdiiefadigkfidqpvktyssgmksrlgfaisvnidpdvlvidealsvgdqtfad
    kcldkmnefkergktiffishsigqvksfcekalwleygevrgygtvaeiipqyekflke
    yramsdkekrqykervmrkqqgeflqaavk
    

    Sequence, based on observed residues (ATOM records):
    >6jbhB (B:)
    ehavivenvtkkyklfkrtserlldmilpggygedfyalrnvsftadkgdvigivgvngs
    gkstlsniiagilpptsgtikidgqasliaissglnnqltgrenielkclmlgfskkqir
    amepdiiefadigkfidqpvktyssgmksrlgfaisvnidpdvlvidealsvgdqtfadk
    cldkmnefkergktiffishsigqvksfcekalwleygevrgygtvaeiipqyekflkey
    ramsdkekrqykervmrkqqgefl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6jbhC (C:)
    mghhhhhhhhhhmrsavtvlmehirnlylirrlslfelksdnsnqylgilweiinpmiqi
    aiywfvfgygirgrhpvghipfilwmlagmtvwffvnqavlqasksvytrirmvaqmnfp
    isviptyvitakfyqhlmllavifiifqftpyhvsvylvqlpyymfgllallvsfslits
    tlatvvrdvqmivqslvrillyltpllwdpshlphlvqvimrlnplyyivegyrsallgt
    swylvdhasytvyfwvvvilffvfgsmvhlkfrahfvdym
    

    Sequence, based on observed residues (ATOM records):
    >6jbhC (C:)
    mrsavtvlmehirnlylirrlslfelksdnsnqylgilweiinpmiqiaiywfvfgygir
    grhpvghipfilwmlagmtvwffvnqavlqasksvytrirmvaqmnfpisviptyvitak
    fyqhlmllavifiifqftpyhvsvylvqlpyymfgllallvsfslitstlatvvrdvqmi
    vqslvrillyltpllwdpshlphlvqvimrlnplyyivegyrsallgtswylvdhasytv
    yfwvvvilffvfgsmvhlkfrahfvdy
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6jbhD (D:)
    mghhhhhhhhhhmrsavtvlmehirnlylirrlslfelksdnsnqylgilweiinpmiqi
    aiywfvfgygirgrhpvghipfilwmlagmtvwffvnqavlqasksvytrirmvaqmnfp
    isviptyvitakfyqhlmllavifiifqftpyhvsvylvqlpyymfgllallvsfslits
    tlatvvrdvqmivqslvrillyltpllwdpshlphlvqvimrlnplyyivegyrsallgt
    swylvdhasytvyfwvvvilffvfgsmvhlkfrahfvdym
    

    Sequence, based on observed residues (ATOM records):
    >6jbhD (D:)
    mrsavtvlmehirnlylirrlslfelksdnsnqylgilweiinpmiqiaiywfvfgygir
    grhpvghipfilwmlagmtvwffvnqavlqasksvytrirmvaqmnfpisviptyvitak
    fyqhlmllavifiifqftpyhvsvylvqlpyymfgllallvsfslitstlatvvrdvqmi
    vqslvrillyltpllwdpshlphlvqvimrlnplyyivegyrsallgtswylvdhasytv
    yfwvvvilffvfgsmvhlkfrahfvdy