PDB entry 6j9a

View 6j9a on RCSB PDB site
Description: crystal structure of arabidopsis thaliana val1 in complex with flc dna fragment
Deposited on 2019-01-22, released 2019-05-29
The last revision was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B3 domain-containing transcription repressor VAL1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: VAL1, HSI2, At2g30470, T6B20.17
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*ap*tp*tp*cp*tp*gp*cp*ap*tp*gp*gp*ap*tp*tp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*tp*cp*cp*ap*tp*gp*cp*ap*gp*ap*ap*tp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6j9aA (A:)
spkytdkevqqisgnlnlnivplfektlsasdagrigrlvlpkacaeayfppisqsegip
lkiqdvrgrewtfqfrywpnnnsrmyvlegvtpciqsmmlqagdtvtfsrvdpggklimg
srkaanagdmqg

    Sequence, based on observed residues (ATOM records):
    >6j9aA (A:)
ivplfektlsasdagrigrlvlpkacaeayfppisqsegiplkiqdvrgrewtfqfrywp
nnnsrmyvlegvtpciqsmmlqagdtvtfsrvdpggklimgsrkaa

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.