PDB entry 6j8y

View 6j8y on RCSB PDB site
Description: crystal structure of the human rad9-hus1-rad1-rhino complex
Deposited on 2019-01-21, released 2019-12-04
The last revision was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell cycle checkpoint control protein RAD9A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAD9A
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Checkpoint protein HUS1
    Species: Homo sapiens [TaxId:9606]
    Gene: HUS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60921 (7-285)
      • expression tag (3-6)
  • Chain 'C':
    Compound: Cell cycle checkpoint protein RAD1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAD1, REC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: RAD9, HUS1, RAD1-interacting nuclear orphan protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RHNO1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6j8yA (A:)
    mkclvtggnvkvlgkavhslsrigdelylepledglslrtvnssrsayacflfaplffqq
    yqaatpgqdllrckilmksflsvfrslamlektvekccislngrssrlvvqlhckfgvrk
    thnlsfqdceslqavfdpascphmlraparvlgeavlpfspalaevtlgigrgrrvilrs
    yheeeadstakamvtemclgeedfqqlqaqegvaitfclkefrgllsfaesanlnlsihf
    dapgrpaiftikdslldghfvlatlsdtds
    

    Sequence, based on observed residues (ATOM records):
    >6j8yA (A:)
    mkclvtggnvkvlgkavhslsrigdelylepledglslrtvnssrsayacflfaplffqq
    yqaatpdllrckilmksflsvfrslamlektvekccislssrlvvqlhckfgvrkthnls
    fqdceslqavfdpascphmlraparvlgeavlpfspalaevtlgigrgrrvilrsyheet
    akamvtemclgeedfqqlqaqegvaitfclkefrgllsfaesanlnlsihfdapgrpaif
    tikdslldghfvlatls
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6j8yB (B:)
    mhhhhhhkfrakivdgaclnhftrisnmiaklaktctlrispdklnfilcdklanggvsm
    wceleqenffnefqmegvsaenneiyleltsenlsralktaqnaralkikltnkhfpclt
    vsvellsmssssrivthdipikviprklwkdlqepvvpdpdvsiylpvlktmksvvekmk
    nisnhlvieanldgelnlkietelvcvtthfkdlgnpplasesthedrnvehmaevhidi
    rkllqflagqqvnptkalcnivnnkmvhfdllhedvslqyfipals
    

    Sequence, based on observed residues (ATOM records):
    >6j8yB (B:)
    hhhhkfrakivdgaclnhftrisnmiaklaktctlrispdklnfilcdkvsmwceleqen
    ffnefqmegvsaenneiyleltsenlsralktaqnaralkikltnkhfpcltvsvellsr
    ivthdipikviprklwkdlqepvvpdpdvsiylpvlktmksvvekmknisnhlvieanld
    gelnlkietelvcvtthfkdlgnpplnvehmaevhidirkllqflagqqvnptkalcniv
    nnkmvhfdllhedvslqyfipals
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6j8yC (C:)
    mplltqqiqdeddqyslvasldnvrnlstilkaihfrehatcfatkngikvtvenakcvq
    anafiqagifqefkvqeesvtfrinltvlldclsifgsspmpgtltalrmcyqgygyplm
    lfleeggvvtvckintqepeetldfdfcstnvinkiilqseglreafseldmtsevlqit
    mspdkpyfrlstfgnagsshldypkdsdlmeafhcnqtqvnrykisllkpstkalvlsck
    vsirtdnrgflslqymirnedgqicfveyyccpdeevpeses
    

    Sequence, based on observed residues (ATOM records):
    >6j8yC (C:)
    yslvasldnvrnlstilkaihfrehatcfatkngikvtvenakcvqanafiqagifqefk
    vqeesvtfrinltvlldclsifgssptltalrmcyqgygyplmlfleeggvvtvckintq
    eptldfdfcstnvinkiilqseglreafseldmtsevlqitmspdkpyfrlstfgnagss
    hldypkdsdlmeafhcnqtqvnrykisllkpstkalvlsckvsirtdnrgflslqymirn
    edgqicfveyyccpd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6j8yD (D:)
    skpidhstitswvspdfdta
    

    Sequence, based on observed residues (ATOM records):
    >6j8yD (D:)
    swvspdfdta