PDB entry 6j8r

View 6j8r on RCSB PDB site
Description: Metallo-Beta-Lactamase VIM-2 in complex with Dual MBL/SBL Inhibitor MS01
Class: hydrolase
Keywords: Metallo-beta-lactamase VIM-2, VIM-2, HYDROLASE
Deposited on 2019-01-21, released 2019-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactamase class b vim-2
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, VIM-2, vim-2, IPC669_36195
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9K2N0 (0-230)
  Domains in SCOPe 2.08: d6j8ra_
• Heterogens: BHU, ZN, FMT, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6j8rA (A:)
  eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
  taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
  thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
  adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr