PDB entry 6j83

View 6j83 on RCSB PDB site
Description: Crystal structure of TleB with NMVT
Class: oxidoreductase
Keywords: P450, indolactam, oxidation, NMVT, OXIDOREDUCTASE
Deposited on 2019-01-18, released 2019-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-17, with a file datestamp of 2021-02-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P-450
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6j83a_
  • Heterogens: HEM, B9R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j83A (A:)
    mgsshhhhhhssglvprgshmkderaplsypfneavaldvdplyaklraeepvvrvscpf
    gedawlvtshadmktiladprfsralaaehdesrltplpihtsilgmdspdhtrlrrlla
    kvftmrrvellrprieqeadrlidaliaegppgdlmegfavpfagtvvcdllgvpfedre
    qfrgwldafsattvmteeeieadterlhgyiaqlmvrrraepqddlisamvkasdeeekl
    sekelvelasvlliaghetvssqlidslhvlfthpeqlrllkdrpelmpgtveelmrfvp
    lishvtfaryatedvelsgtlvragesvlpaipsanrdesvfenadrfdltrehnphlgf
    gygihrclgaplarlemqvaldsllrrlpelrcavpaeslewkdgmqvrsllelpvlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j83A (A:)
    plsypfneavaldvdplyaklraeepvvrvscpfgedawlvtshadmktiladprfsral
    aaehdesrltplpihtsilgmdspdhtrlrrllakvftmrrvellrprieqeadrlidal
    iaegppgdlmegfavpfagtvvcdllgvpfedreqfrgwldafsattvmteeeieadter
    lhgyiaqlmvrrraepqddlisamvkasdeeeklsekelvelasvlliaghetvssqlid
    slhvlfthpeqlrllkdrpelmpgtveelmrfvplishvtfaryatedvelsgtlvrage
    svlpaipsanrdesvfenadrfdltrehnphlgfgygihrclgaplarlemqvaldsllr
    rlpelrcavpaeslewkdgmqvrsllelpvlw