PDB entry 6j7w

View 6j7w on RCSB PDB site
Description: Crystal Structure of Human BCMA in complex with UniAb(TM) VH
Class: immune system
Keywords: Heavy chain antibodies, VH domains, domain antibodies, IMMUNE SYSTEM
Deposited on 2019-01-18, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UniAb
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6J7W (0-117)
    Domains in SCOPe 2.07: d6j7wa_
  • Chain 'B':
    Compound: UniAb
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6J7W (0-117)
    Domains in SCOPe 2.07: d6j7wb_
  • Chain 'C':
    Compound: Tumor necrosis factor receptor superfamily member 17
    Species: Homo sapiens [TaxId:9606]
    Gene: BCMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j7wc_
  • Chain 'D':
    Compound: Tumor necrosis factor receptor superfamily member 17
    Species: Homo sapiens [TaxId:9606]
    Gene: BCMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j7wd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6j7wA (A:)
    evqlvesggglvqpggslrlscaasgftvssygmswvrqapgkgpewvsgirgsdgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycakqgendgpfdhrgqgtlvtvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6j7wB (B:)
    evqlvesggglvqpggslrlscaasgftvssygmswvrqapgkgpewvsgirgsdgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycakqgendgpfdhrgqgtlvtvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6j7wC (C:)
    gqcsqneyfdsllhacipcqlrcssntppltcqrycnas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6j7wD (D:)
    gqcsqneyfdsllhacipcqlrcssntppltcqrycnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j7wD (D:)
    gqcsqneyfdsllhacipcqlrcssntppltcqryc