PDB entry 6j7s

View 6j7s on RCSB PDB site
Description: crystal structure of toxin tglt (unusual type guanylyltransferase-like toxin, rv1045) wild type protein from mycobacterium tuberculosis
Deposited on 2019-01-18, released 2020-05-13
The last revision was dated 2020-05-20, with a file datestamp of 2020-05-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanylyltransferase-like toxin
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv1045
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6j7sA (A:)
    mgsshhhhhhssglvprgshmtkpysspptnlrslrdrltqvaerqgvvfgrlqrhvami
    vvaqfaatltddtgaplllvkggsslelrrgipdsrtskdfdtvarrdieliheqladag
    etgwegftaiftapeeidvpgmpvkprrftaklsyrgrafatvpievssveagnadqfdt
    ltsdalglvgvpaavavpcmtipwqiaqklhavtavleepkvndrahdlvdlqlleglll
    dadlmptrsaciaifearaqhpwpprvatlphwpliyagalegldhlelartvdaaaqav
    qrfvaridratkr
    

    Sequence, based on observed residues (ATOM records):
    >6j7sA (A:)
    pysspptnlrslrdrltqvaerqgvvfgrlqrhvamivvaqfaatltddtgaplllvkgg
    sslelrrgipdsrtskdfdtvarrdieliheqladagetgwegftaiftapeeidvpgmp
    vkprrftaklsyrgrafatvpievssveagnadqfdtltsdalglvgvpaavavpcmtip
    wqiaqklhavtavleepkvndrahdlvdlqllegllldadlmptrsaciaifearaqhpw
    pprvatlphwpliyagalegldhlelartvdaaaqavqrfvaridratk