PDB entry 6j6j

View 6j6j on RCSB PDB site
Description: biotin-bound streptavidin
Deposited on 2019-01-15, released 2019-05-29
The last revision was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: EM
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BTN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6j6jA (A:)
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6j6jB (B:)
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6j6jC (C:)
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6j6jD (D:)
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk