PDB entry 6j5w

View 6j5w on RCSB PDB site
Description: ligand-triggered allosteric adp release primes a plant nlr complex
Deposited on 2019-01-12, released 2019-04-03
The last revision was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: EM
Resolution: 3.7 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disease resistance RPP13-like protein 4
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RPP13L4, ZAR1, At3g50950, F18B3.230
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: rks1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g57710
    Database cross-references and differences (RAF-indexed):
    • Uniprot U5LSK3
      • conflict (114)
  • Heterogens: ADP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6j5wA (A:)
    mvdavvtvflektlnileekgrtvsdyrkqledlqselkymqsflkdaerqkrtnetlrt
    lvadlrelvyeaedilvdcqladgddgneqrssnawlsrlhparvplqykkskrlqeine
    ritkiksqvepyfefitpsnvgrdngtdrwsspvydhtqvvglegdkrkikewlfrsnds
    qllimafvgmgglgkttiaqevfndkeiehrferriwvsvsqtfteeqimrsilrnlgda
    svgddigtllrkiqqyllgkrylivmddvwdknlswwdkiyqglprgqggsvivttrses
    vakrvqarddkthrpellspdnswllfcnvafaandgtcerpeledvgkeivtkckglpl
    tikavgglllckdhvyhewrriaehfqdelrgntsetdnvmsslqlsydelpshlkscil
    tlslypedcvipkqqlvhgwigegfvmwrngrsatesgedcfsgltnrclievvdktysg
    tiitckihdmvrdlvidiakkdsfsnpeglncrhlgisgnfdekqikvnhklrgvvsttk
    tgevnklnsdlakkftdckylrvldisksifdaplseildeiaslqhlaclslsnthpli
    qfprsmedlhnlqildasycqnlkqlqpcivlfkkllvldmtncgslecfpkgigslvkl
    evllgfkparsnngcklsevknltnlrklglsltrgdqieeeeldslinlsklmsisinc
    ydsygddlitkidaltpphqlhelslqfypgksspswlsphklpmlrymsicsgnlvkmq
    epfwgnenthwrieglmlsslsdldmdwevlqqsmpylrtvtanwcpelesfaiedvgfr
    ggvwmktplhrt
    

    Sequence, based on observed residues (ATOM records):
    >6j5wA (A:)
    mvdavvtvflektlnileekgrtvsdyrkqledlqselkymqsflkdaerqkrtnetlrt
    lvadlrelvyeaedilvdcqladgddgneqrssnawlsrlhparvplqykkskngtdrws
    spvydhtqvvglegdkrkikewlfrsndsqllimafvgmgglgkttiaqevfndkeiehr
    ferriwvsvsqtfteeqimrsilrnlgdasvgddigtllrkiqqyllgkrylivmddvwd
    knlswwdkiyqglprgqggsvivttrsesvakrvqarddkthrpellspdnswllfcnva
    faandgtcerpeledvgkeivtkckglpltikavgglllckdhvyhewrriaehfqdelr
    gntsetdnvmsslqlsydelpshlksciltlslypedcvipkqqlvhgwigegfvmwrng
    rsatesgedcfsgltnrclievvdktysgtiitckihdmvrdlvidiakkdsfsnpegln
    crhlgisgnfdekqikvnhklrgvvsttktgevnklnsdlakkftdckylrvldisksif
    daplseildeiaslqhlaclslsnthpliqfprsmedlhnlqildasycqnlkqlqpciv
    lfkkllvldmtncgslecfpkgigslvklevllgfkparsnngcklsevknltnlrklgl
    sltrgdqieeeeldslinlsklmsisincydsygddlitkidaltpphqlhelslqfypg
    ksspswlsphklpmlrymsicsgnlvkmqepfwgnenthwrieglmlsslsdldmdwevl
    qqsmpylrtvtanwcpelesfaiedvgfrggvwmkt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6j5wB (B:)
    mkkqylksgsgtrkekdkakrwfldngsiflrelvadcngksipirsfspeqilkatnnf
    dsscfvsqdvyykwyrgeiedrsymikrfsedeitgkrhrvkevyndivlsarmsnhsnf
    lqllgcclefpfpvlvfefaehgamnqrggvivngeesllpwsvrlkigkeianavtylh
    tafpkiiihrdvkpmhvfldknwtaklsdlsfsislpegksrieaewvlgtfgyidplyh
    ktcfvteytdvysfgicllviitgkpaimtisdgdlqgilslvrelcengkldevidprl
    mkditsgqrlqveacvvlalrcckerdedrpkmiqvakelkqieaslknss
    

    Sequence, based on observed residues (ATOM records):
    >6j5wB (B:)
    ekdkakrwfldngsiflrelvadcngksipirsfspeqilkatnnfdsscfvsqdvyykw
    yrgeiedrsymikrfsedeitgkrhrvkevyndivlsarmsnhsnflqllgcclefpfpv
    lvfefaehgamnqrggvivngeesllpwsvrlkigkeianavtylhtafpkiiihrdvkp
    mhvfldknwtaklsdlsfsitcfvteytdvysfgicllviitgkpaimtisdgdlqgils
    lvrelcengkldevidprlmkditsgqrlqveacvvlalrcckerdedrpkmiqvakelk
    qieasl