PDB entry 6j5q

View 6j5q on RCSB PDB site
Description: OspA mutant, PSAM-VLGDV1-form7, grafted short chameleon sequence from alpha-B crystallin
Class: lipid binding protein
Keywords: Peptide Self-Assembly Mimic, single-layer beta-sheet, chameleon sequence, LIPID BINDING PROTEIN
Deposited on 2019-01-11, released 2019-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: Outer surface protein A
    Species: Borreliella burgdorferi [TaxId:139]
    Gene: ospA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45040 (Start-250)
      • engineered mutation (14)
      • engineered mutation (22-23)
      • engineered mutation (25)
      • engineered mutation (37)
      • engineered mutation (41)
      • engineered mutation (60)
      • engineered mutation (81)
      • engineered mutation (84)
      • engineered mutation (97-101)
      • engineered mutation (173)
      • engineered mutation (216-217)
      • engineered mutation (231)
    Domains in SCOPe 2.08: d6j5qo_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6j5qO (O:)
    gshmknsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkad
    askvkltisddlgqttlevfksdgstlvskkvtskdkvlgdvkfnekgevsekiitradg
    trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsveln
    dtdssaatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsavei
    tkldeiknalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j5qO (O:)
    nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
    ltisddlgqttlevfksdgstlvskkvtskdkvlgdvkfnekgevsekiitradgtrley
    tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsvelndtdss
    aatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitklde
    iknalk