PDB entry 6j51

View 6j51 on RCSB PDB site
Description: rna polymerase ii elongation complex bound with spt4/5 and foreign dna, stalled at shl(-1) of the nucleosome, weak elf1 (+1 position)
Deposited on 2019-01-10, released 2019-02-20
The last revision was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: EM
Resolution: 4.2 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: DNA (36-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain '1':
    Compound: DNA (36-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'A':
    Compound: DNA-directed RNA polymerase subunit
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA-directed RNA polymerase subunit beta
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: RNA polymerase II third largest subunit B44, part of central core
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: RNA polymerase II subunit B32
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: RNA polymerase II subunit
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC3
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: DNA-directed RNA polymerase subunit
    Species: Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) [TaxId:981350]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: RNA polymerase II subunit B12.5
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: RNA polymerase subunit ABC10-alpha
    Species: Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) [TaxId:981350]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Transcription elongation factor 1 homolog
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Gene: PAS_c121_0006
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: DNA (198-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'P':
    Compound: RNA (5'-r(p*cp*cp*up*gp*gp*up*gp*up*cp*up*up*gp*gp*gp*up*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'T':
    Compound: DNA (198-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'V':
    Compound: Transcription elongation factor SPT4
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Gene: PAS_chr2-1_0350
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Protein that forms a complex with Spt4p
    Species: Komagataella phaffii (strain GS115 / ATCC 20864) [TaxId:644223]
    Gene: PAS_chr3_1136
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: Histone H3.3
    Species: Homo sapiens [TaxId:9606]
    Gene: H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Histone H2A type 1-B/E
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H2AB, H2AFM, HIST1H2AE, H2AFA
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Histone H2B type 1-J
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H2BJ, H2BFR
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Histone H3.3
    Species: Homo sapiens [TaxId:9606]
    Gene: H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Histone H2A type 1-B/E
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H2AB, H2AFM, HIST1H2AE, H2AFA
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Histone H2B type 1-J
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H2BJ, H2BFR
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '0':
    No sequence available.

  • Chain '1':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6j51A (A:)
    msqfpyssaplrsvkevqfgllspeeiraisvvkieypeimdesrqrpregglndpklgs
    idrnfkcqtcgegmaecpghfghmelakpvfhigfipkikkvcecicmncgkllldetnp
    tmaqairirdpkkrfnavwqlcktkmvceadapvdeyseqkvvsrggcgntqpvvrkdgm
    klwgtwkksgfsdrdaqperklltpgeilnvfkhispedcfrlgfnedyarpewmiitvl
    pvpppqvrpsiamdettqgqddlthklsdilkaninvqklemdgspqhiineveqllqfh
    vatymdndiagqpqalqksgrpvkairarlkgkegrlrgnlmgkrvdfsartvisgdpnl
    eldqvgvpisiaktlsypetvtqynihrlteyvrngpnehpgakyvirdngdridlryhk
    ragdivlqygwkverhlmdddpvlfnrqpslhkmsmmahrvkvmpystfrlnlsvtspyn
    adfdgdemnlhvpqseetraelsqlcavplqivspqsnkpvmgivqdtlcgvrkmtlrdt
    fieyeqvmnmlfwvpswdgvvpqpailkpkplwtgkqllsiaipsgihlqrtdggnslls
    pkdngmlivdgkvmfgvvdkktvgsgggglihtvmrekgpkicaelfgniqkvvnywllh
    ngfsigigdaiadastmkeithaissakeqvqeiiykaqhnelelkpgmtlresfegevs
    rtlndardsagrsaemnlkdlnnvkqmvsagskgsfiniaqmsacvgqqmvegkriafgf
    adrslphftkddfspeskgfvensylrgltpqefffhamagreglidtavktaetgyiqr
    rlvkaledimvhydgttrnslgdiiqflygedgldgtqverqtidtipgsdkafhkryyv
    dlmdeknsikpdvieyaadilgdvelqkelnseyeqlvsdrkflreivfvngdhnwplpv
    nlrriiqnaqqifhldrakasdltipeiihgvrdlckklfvlrgenelikeaqqnatslf
    qclvrarlatrrileefrlnrdafewvlgtieaqfqrslvhpgemvgviaaqsigepatq
    mtlntfhyagvssknvtlgvprlkeilnvakniktpaltvyldreialdiekakviqssi
    eyttlknvtsateiyydpdptstvieedfdtveayfsipdekveetidkqspwllrleld
    rarmldkqltmnqvadkisevfsddlfvmwsednadkliircrvirdpkamdeeleaeed
    qmlkrieahmldlialrgipgiskvymvkhkvsvpdesgeykneelwaletdginlaevm
    avpgvdssrtysnsfveilsvlgieatrsslykeilnviafdgsyvnyrhmallvdvmts
    rgylmaitrhginradtgalmrcsfeetveilfeagaaaelddcrgvsenvmlgqlapmg
    tgafdvmideklltslpadyaptmplfkgkatqgsatpydnnaqyddefnhddvadvmfs
    pmaetgsgddrsgglteyagiqspyqptspglsatspgfaptspgfaptsprysptspgy
    sptspsysptspsysptspsysptspsysptspsysptspsysptspsysptspsyspts
    psysptspqysptspqysptspqysptspqysptspqysptspqysptspqysptspqys
    ptspqysptspqysptspqysptspqysptspqysptspqyspaspqyspsrhspngesk
    ege
    

    Sequence, based on observed residues (ATOM records):
    >6j51A (A:)
    sqfpyssaplrsvkevqfgllspeeiraisvvkieypeimdesrqrpregglndpklgsi
    drnfkcqtcgegmaecpghfghmelakpvfhigfipkikkvcecicmncgkllldetnpt
    maqairirdpkkrfnavwqlcktkmvceadapsrggcgntqpvvrkdgmklwgtwkksrd
    aqperklltpgeilnvfkhispedcfrlgfnedyarpewmiitvlpvpppqvrpsiamde
    ttqgqddlthklsdilkaninvqklemdgspqhiineveqllqfhvatymdndiagqpqa
    lqksgrpvkairarlkgkegrlrgnlmgkrvdfsartvisgdpnleldqvgvpisiaktl
    sypetvtqynihrlteyvrngpnehpgakyvirdngdridlryhkragdivlqygwkver
    hlmdddpvlfnrqpslhkmsmmahrvkvmpystfrlnlsvtspynadfdgdemnlhvpqs
    eetraelsqlcavplqivspqsnkpvmgivqdtlcgvrkmtlrdtfieyeqvmnmlfwvp
    swdgvvpqpailkpkplwtgkqllsiaipsgihlqrtdggnsllspkdngmlivdgkvmf
    gvvdkktvgsgggglihtvmrekgpkicaelfgniqkvvnywllhngfsigigdaiadas
    tmkeithaissakeqvqeiiykaqhnelelkpgmtlresfegevsrtlndardsagrsae
    mnlkdlnnvkqmvsagskgsfiniaqmsacvgqqmvegkriafgfadrslphftkddfsp
    eskgfvensylrgltpqefffhamagreglidtavktaetgyiqrrlvkaledimvhydg
    ttrnslgdiiqflygedgldgtqverqtidtipgsdkafhkryyvdlmdeknsikpdvie
    yaadilgdvelqkelnseyeqlvsdrkflreivfvngdhnwplpvnlrriiqnaqqifhl
    drakasdltipeiihgvrdlckklfvlrgenelikeaqqnatslfqclvrarlatrrile
    efrlnrdafewvlgtieaqfqrslvhpgemvgviaaqsigepatqmnvtlgvprlkeiln
    vakniktpaltvyldreialdiekakviqssieyttlknvtsateiyydpdptstvieed
    fdtveayfsqspwllrleldrarmldkqltmnqvadkisevfsddlfvmwsednadklii
    rcrvieedqmlkrieahmldlialrgipgiskvymvkhkvsvpdesgeykneelwaletd
    ginlaevmavpgvdssrtysnsfveilsvlgieatrsslykeilnviafdgsyvnyrhma
    llvdvmtsrgylmaitrhginradtgalmrcsfeetveilfeagaaaelddcrgvsenvm
    lgqlapmgtgafdvmideklltslpadyapt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6j51B (B:)
    msydpysiddtittedcwtvisaffeekglvsqqldsfdefmetsiqdlvweeprlildq
    paqhtnekdninkryeirfgkiylsrptmteadgtthamfpqearlrnltysspvyldme
    ksmftsiddegnpnatldwqqvhepikdgveegnkvhigkvpimlrskfcslrtldevdl
    ykmkecpydmggyfvingsekvliaqersaanivqvfkkaapspishvaeirsalekgsr
    listmqiklygredkgtgrtikatlpyvkqdipivivfralgvvpdgeilqhicydendw
    qmlemlkpcieegfviqdkevaldfigrrgsaalgirrekriqyakdilqkellphitqe
    egfetrktfflgymvnrlllcalerkdqddrdhfgkkrldlagpllanlfrilfrkltre
    iyrymqrcietdrdfnlnlavksttitsglkyslatgnwgeqkkamssragvsqvlnryt
    ysstlshlrrtntpigrdgklakprqlhnthwglvcpaetpegqacglvknlsllsgisi
    gspsepiinfleewgmepledydpaqhtkstrifvngvwtgihrdpsmlvstmrdlrrsg
    aispevsiirdirerefkiftdvgrvyrplfiveddeskdnkgelritkehirkiqqgyd
    ddamnddseeqeqdvygwsslvtsgvieyvdgeeeetimiamtpedlqtrsleqkeidln
    dtakrikpemstsshhtfthceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgv
    fltnynvrmdtmanilyypqkplaktqameylkfrelpagqnaivaiacysgynqedsmi
    mnqssidrglfrslffrsymdqekrfgisiveefekptrattlrlkhgtyekldedglia
    pgvrvsgddiiigkttpippdteelgqrtkyhtkrdastplrstengivdqvllttnqeg
    lkfvkvrmrttkvpqigdkfasrhgqkgtigvtyrhedmpfsaegivpdliinphaipsr
    mtvahliecllskvgsirgyegdatpftdltvdavsnllrdngyqsrgfevmynghtgkk
    lmaqvffgptyyqrlrhmvddkiharargpvqvltrqpvegrsrdgglrfgemerdcmia
    hgaagflkerlmeasdafrvhvcgicglmsvianlkknqfecrscknktniyqlhipyaa
    kllfqelmamniaprlytersgvsmrs
    

    Sequence, based on observed residues (ATOM records):
    >6j51B (B:)
    ddtittedcwtvisaffeekglvsqqldsfdefmetsiqdlvweeprlildqpaqhdnin
    kryeirfgkiylsrptmteadgtthamfpqearlrnltysspvyldmeksmftsidgnkv
    higkvpimlrskfcslrtldevdlykmkecpydmggyfvingsekvliaqersaanivqv
    fkkaapspishvaeirsalekgsrlistmqiklygredkgtgrtikatlpyvkqdipivi
    vfralgvvpdgeilqhicydendwqmlemlkpcieegfviqdkevaldfigrrgsaalgi
    rrekriqyakdilqkellphitqeegfetrktfflgymvnrlllcalerkdqddrdhfgk
    krldlagpllanlfrilfrkltreiyrymqrcietdrdfnlnlavksttitsglkyslat
    gnwgeqkkamssragvsqvlnrytysstlshlrrtntpigrdgklakprqlhnthwglvc
    paetpegqacglvknlsllsgisigspsepiinfleewgmepledydpaqhtkstrifvn
    gvwtgihrdpsmlvstmrdlrrsgaispevsiirdirerefkiftdvgrvyrplfivedd
    eskdnkgelritkehirkiqqgydddvygwsslvtsgvieyvdgeeeetimiamtpedlq
    trslndtakrikpemstsshhtfthceihpsmilgvaasiipfpdhnqsprntyqsamgk
    qamgvfltnynvrmdtmanilyypqkplaktqameylkfrelpagqnaivaiacysgynq
    edsmimnqssidrglfrslffrsymdqekrfgisiveefekptrattlrlkhgtyeklde
    dgliapgvrvsgddiiigkttpippyhtkrdastplrstengivdqvllttnqeglkfvk
    vrmrttkvpqigdkfasrhgqkgtigvtyrhedmpfsaegivpdliinphaipsrmtvah
    liecllskvgsirgyegdatpftdltvdavsnllrdngyqsrgfevmynghtgkklmaqv
    ffgptyyqrlrhmvddkiharargpvqvltrqpvegrsrdgglrfgemerdcmiahgaag
    flkerlmeasdafrvhvcgicglmsvianlkknqfecrscknktniyqlhipyaakllfq
    elmamniaprlytersg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6j51C (C:)
    mskepkvniinaqddevelmlsdvnlslanslrrtmlaevptlaidlveikmntsvlade
    fishrlgliplvsedveemkysrdctcedycdecsvvlelsarhegeegttdvyssslik
    vsgpgnlnvgepvrrddydqgillcklrnhqelnirciakkgiakehakwspcsaiafey
    dphnklkhtdfwfevdakkewpdskyatweeppkpgevfdykakpnrfymtvettgslka
    nqvfsrgiktlqeklanvlfelensrpanttayggatayggqtvygretsyggntnygdy
    napy
    

    Sequence, based on observed residues (ATOM records):
    >6j51C (C:)
    epkvniinaqddevelmlsdvnlslanslrrtmlaevptlaidlveikmntsvladefis
    hrlgliplvsedveemkysrdctcedycdecsvvlelsarhegeegttdvyssslikvsg
    pgnlnvgepvrrddydqgillcklrnhqelnirciakkgiakehakwspcsaiafeydph
    nklkhtdfwfevdakkewpdskyatweeppkpgevfdykakpnrfymtvettgslkanqv
    fsrgiktlqeklanvlfelensr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6j51D (D:)
    mnvststvgarrrrakqqvddeenatllrlgpefalkqydhdgnehdlialslsesrlli
    realkarsrarnggvdiessngeidddelakvtsgavangvvkktldylntfarfkdeet
    ctavdqllhnssdcsvlhpfeiaqlsslgcedvdeaitlipslaakkevnlqrildelnr
    ledpyk
    

    Sequence, based on observed residues (ATOM records):
    >6j51D (D:)
    vststvgarrrrakqqvddeenatllrlgpefalkqydhdgnehdlialslsesrllire
    alkarsrarnggvidddelakvtsgavangvvkktldylntfarfkdeetctavdqllhl
    hpfeiaqlsslgcedvdeaitlipslaakkevnlqrildelnrledpy
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6j51E (E:)
    mednnriisrlwrsfrtvkemaadrgyfisqeemdqsleefrskicdsmgnpqrklmsfl
    anptpealekysdlgtlwvefcdepsvgiktmrnfclriqeknfstgifiyqnnitpsan
    kmiptvspaiietfqesdlvvnithhelvpkhirlsdgeksqllqryklkesqlpriqre
    dpvarylglkrgqvvkiirrsetsgryasyricl
    

    Sequence, based on observed residues (ATOM records):
    >6j51E (E:)
    ednnriisrlwrsfrtvkemaadrgyfisqeemdqsleefrskicdsmgnpqrklmsfla
    nptpealekysdlgtlwvefcdepsvgiktmrnfclriqeknfstgifiyqnnitpsank
    miptvspaiietfqesdlvvnithhelvpkhirlsdgeksqllqryklkesqlpriqred
    pvarylglkrgqvvkiirrsetsgryasyricl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6j51F (F:)
    msedeafneqtenfenfedehfsddnfedrstqpedyavgvtadgrqiingdgiqevngt
    ikahrkrsnkelailkeertttpyltkyerarilgtralqismnapvlvdiegetdplqi
    amkelsqrkiplvirrylpdgsyedwgcdelivdn
    

    Sequence, based on observed residues (ATOM records):
    >6j51F (F:)
    elailkeertttpyltkyerarilgtralqismnapvlvdiegetdplqiamkelsqrki
    plvirrylpdgsyedwgcdelivd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >6j51G (G:)
    mfflkdlsliltlhpsyfgpqmnqylreklltdvegtctgqfgyivtvldgmnidvgkgr
    iipgsgsaefevkyravvwkpfkgevvdaivsnvspigffadvgplnvfvstrlipdnlv
    ynpsnsppaymsndelitkgskvrlkvvgtrtdvneiyaigsikedflgai
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6j51H (H:)
    mssalfddiftvqtvdngrynkvsriigisttnsaikltldinnemfpvsqddsltvtla
    nslsldgedesanfskswrppkptdksladdydyvmfgtvykfeegdedkikvyvsfggl
    lmcleggykslaslkqdnlyilirr
    

    Sequence, based on observed residues (ATOM records):
    >6j51H (H:)
    salfddiftvqtvdngrynkvsriigisttnsaikltldinnemfpvsqddsltvtlans
    lslkswrppkptdksladdydyvmfgtvykfeegdedkikvyvsfggllmcleggyksla
    slkqdnlyilirr
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >6j51I (I:)
    masfrfclecnnmlypkedkenqrllyscrncdytelaedpkvyrhelitnigetagivd
    digqdptlprsdkecpechsrdcvffqsqqrrkdtnmtlfyvclnckktfrdese
    

    Sequence, based on observed residues (ATOM records):
    >6j51I (I:)
    sfrfclecnnmlypkedkenqrllyscrncdytelaedpkvyrhelitnigetagivddi
    gqdptlprsdkecpechsrdcvffqsqqrrkdtnmtlfyvclnckktfrde
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6j51J (J:)
    miipvrcfscgkvvgdkwdaylrlleegkqegdaldelklkryccrrmvlthvdliekfl
    rynplekkdfds
    

    Sequence, based on observed residues (ATOM records):
    >6j51J (J:)
    miipvrcfscgkvvgdkwdaylrlleegkqegdaldelklkryccrrmvlthvdliekfl
    rynple
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >6j51K (K:)
    mnapdrfelfilpddvpklkitpdsrvpnciiikferedhtlanllreelalypdvtfva
    ykvehplfanfvmrlqteegtrpkqaleracasiinklktldhkfneewniknfslnd
    

    Sequence, based on observed residues (ATOM records):
    >6j51K (K:)
    mnapdrfelfilpddvpklkitpdsrvpnciiikferedhtlanllreelalypdvtfva
    ykvehplfanfvmrlqteegtrpkqaleracasiinklktldhkfneewnikn
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6j51L (L:)
    msregfvapsgtdlaaaasgvapnkhygvkytcgacahnfslnksdpvrckecghrviyk
    artkrmiqfdar
    

    Sequence, based on observed residues (ATOM records):
    >6j51L (L:)
    gvkytcgacahnfslnksdpvrckecghrviykartkrmiqfdar
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >6j51M (M:)
    gpgmgkrkssarkpapkikqkletqftclfcnhdnsvvctldkknsiglleckkcnlsfq
    apinslsqpidiysdwidaceavaeenadvngdnfiendgadreqdddyddef
    

    Sequence, based on observed residues (ATOM records):
    >6j51M (M:)
    ikqkletqftclfcnhdnsvvctldkknsiglleckkcnlsfqapinslsqpidiysdwi
    dace
    

  • Chain 'N':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records:
    >6j51V (V:)
    mreracmlcgivlpgrvfmqngcpncdsvlnlrdsdqatvnectsssfeglvavgdnehs
    wvakwlrvdrfqpglyavrvdgrlpsdivaaleqygvyyrprdgsvid
    

    Sequence, based on observed residues (ATOM records):
    >6j51V (V:)
    eracmlcgivlpgrvfmqngcpncdsvlnlrdsdqatvnectsssfeglvavgdnehswv
    akwlrvdrfqpglyavrvdgrlpsdivaaleqygvyyrprdg
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >6j51W (W:)
    gpgmsethknqldkvstvspdgpseavkehslqskdlskndgqfivpldrnvieqeehkq
    vkssaqahnttgdaadneiedgvpsedvefdkfkeddydeddeveeegdirsrkrrrhnq
    fldveaevddeeddddddddvelkhdfiqddhiqhetqnegfiaghvdddrlhrkldqsr
    ekiadqdaqeladefkqrygrsasskymgsasttapqrlliptvddpgiwgvkvrlgkek
    dvvrqilkkklaregtknpleiysafqrdsfkghvyiearkaeaindalkgnvnvfsnns
    kflvgiveykdllrpvkssdvkltrgsyvrvkngkfkgdlaqvdevlenglearlklvpr
    ldygkdlshlstsssvdstknrrkfytskfrpaqrlfseaearvheptirrdrdgfvtyg
    geeyyegflyktfrlqnlivnsinptlnelslfqsneesttidlstiadslketaknlvs
    fqpgdnveiingelnhltgtvssvnqstivsvrlhsdddtinsetveiptsdlrkifnvg
    dhvrvihgkhtddtglivevngdkvefisnqtkrtvivfsnylikstdstvsinesgrfe
    lhdlvqvnsdlvgiviraqkdsfdvlcsdgkllslppvsiysklnlnpnqqiaidsngve
    vkvgdtvreftgerrqgtilhvyrnflflrsreivenqgvfvtssnrvktitsksngtgg
    qisgpdlsrmnpsrvipppsipvanqrmtgrdptlnktvkirqggykgkigivkeangdr
    frvelhnpnktipipcsflliesthgwvpyedfvasdrrggniprheisghvqqpqhgra
    pawgsggktpawgsggktpawgsggsggktpawgsggktptwgsgaktpawgsgsktpaw
    sgldeedrrdf
    

    Sequence, based on observed residues (ATOM records):
    >6j51W (W:)
    pqrlliptvddpgiwgvkvrlgkekdvvrqilkkklaregtknpleiysafqrdsfkghv
    yiearkaeaindalkgnvnvfsnnskflvgiveykdllrpvkltrgsyvrvkngkfkgdl
    aqvdevlenglearlklvprldygkdlsytskfrpaqrlfseaearvheirrdrdgfvty
    ggeeyyegflyktfrlqnlivnsinptlnelslfdptlnktvkirqggykgkigivkean
    gdrfrvelhnpnktipipcsflliesthgwvpyed
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >6j51a (a:)
    gshmartkqtarkstggkaprkqlatkaarksapstggvkkphryrpgtvalreirryqk
    stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
    vtimpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records):
    >6j51a (a:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqsaaigalqease
    aylvglfedtnlcaihakrvtimpkdiqlarrirger
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >6j51b (b:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records):
    >6j51b (b:)
    rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
    amdvvyalkrqgrtlygfgg
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >6j51c (c:)
    gshmsgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavle
    yltaeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavll
    pkkteshhkakgk
    

    Sequence, based on observed residues (ATOM records):
    >6j51c (c:)
    trssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnkk
    triiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >6j51d (d:)
    gshmpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtk
    avtkytsak
    

    Sequence, based on observed residues (ATOM records):
    >6j51d (d:)
    rsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >6j51e (e:)
    gshmartkqtarkstggkaprkqlatkaarksapstggvkkphryrpgtvalreirryqk
    stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
    vtimpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records):
    >6j51e (e:)
    hryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqsaaigalqeasea
    ylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >6j51f (f:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records):
    >6j51f (f:)
    niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalkrqgrtlygfgg
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >6j51g (g:)
    gshmsgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavle
    yltaeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavll
    pkkteshhkakgk
    

    Sequence, based on observed residues (ATOM records):
    >6j51g (g:)
    aktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >6j51h (h:)
    gshmpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtk
    avtkytsak
    

    Sequence, based on observed residues (ATOM records):
    >6j51h (h:)
    kesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsre
    iqtavrlllpgelakhavsegtkavtkytsa