PDB entry 6j4i

View 6j4i on RCSB PDB site
Description: A conserved and buried edge-to-face aromatic interaction in SUMO is vital for the SUMO pathway
Class: immune system
Keywords: Post-translational modifier, IMMUNE SYSTEM
Deposited on 2019-01-09, released 2019-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (11-107)
      • engineered mutation (74)
    Domains in SCOPe 2.08: d6j4ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6j4iA (A:)
rgshhhhhhgsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklke
sycqrqgvpmnslrllfegqriadnhtpkelgmeeedvievyqeqtgg

    Sequence, based on observed residues (ATOM records): (download) 
    >6j4iA (A:)
msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
slrllfegqriadnhtpkelgmeeedvievyqeqtgg