PDB entry 6j4e

View 6j4e on RCSB PDB site
Description: crystal structure of the atwrky1 domain
Deposited on 2019-01-08, released 2020-01-15
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: WRKY transcription factor 1
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: WRKY1, ZAP1, At2g04880, F1O13.1, F28I8.34
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9SI37
• Chain 'C':
  Compound: DNA (5'-d(*ap*gp*cp*cp*tp*tp*tp*gp*ap*cp*cp*ap*gp*cp*g)-3')
  Species: Arabidopsis thaliana, synthetic [TaxId:3702]
  
• Chain 'D':
  Compound: DNA (5'-d(*tp*cp*gp*cp*tp*gp*gp*tp*cp*ap*ap*ap*gp*gp*c)-3')
  Species: Arabidopsis thaliana, synthetic [TaxId:3702]
  
• Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'B':
  Sequence, based on SEQRES records:
  

  >6j4eB (B:)
  mnspfirekvmedgynwrkygqklvkgnefvrsyyrcthpnckakkqlersaggqvvdtv
  yfgehdhpkplclehhhhhh
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6j4eB (B:)
  vmedgynwrkygqklvkgnefvrsyyrcthpnckakkqlersaggqvvdtvyfgehdhpk
  p
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.