PDB entry 6j4d

View 6j4d on RCSB PDB site
Description: crystal structure of marh, an epimerase for biosynthesis of maremycins in streptomyces, under ph 4.7, without zn
Deposited on 2019-01-08, released 2020-01-15
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cupin superfamily protein
    Species: Streptomyces sp. B9173 [TaxId:1462558]
    Gene: marH
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FLC, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6j4dA (A:)
gsrpadpeiveglpiplavaghhqpapfyltadmfgglpvqlaggelstlvgkpvaapht
hpvdelyllvspnkggarievqldgrrhellspavmripagsehcfltleaevgsycfgi
llgdrl

    Sequence, based on observed residues (ATOM records):
    >6j4dA (A:)
adpeiveglpiplavaghhqpapfyltadmfgglpvqlaggelstlvgkpvaaphthpvd
elyllvspnkggarievqldgrrhellspavmripagsehcfltleaevgsycfgillgd
rl