PDB entry 6j3n

View 6j3n on RCSB PDB site
Description: rorgammat lbd complexed with ursonic acid and src2.2
Deposited on 2019-01-05, released 2020-01-15
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (1-245)
      • expression tag (0)
  • Chain 'B':
    Compound: lys-ile-leu-his-arg-leu-leu-gln
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6J3N (0-7)
  • Heterogens: B8F, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6j3nA (A:)
    paslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfste
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6j3nB (B:)
    kilhrllq