PDB entry 6j3l

View 6j3l on RCSB PDB site
Description: solution structure of the n-terminal extended protuberant domain of eukaryotic ribosomal stalk protein p0
Deposited on 2019-01-04, released 2019-09-04
The last revision was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60S acidic ribosomal protein P0
    Species: Bombyx mori [TaxId:7091]
    Gene: p0
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70YZ3 (4-85)
      • cloning artifact (3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6j3lA (A:)
gshmnkvqaparpgaiaplsvvipahntglgpektsffqalsiptkiskgtieiindvhi
lkpgdkvgaseatllnmlnispfsyg

    Sequence, based on observed residues (ATOM records):
    >6j3lA (A:)
mnkvqaparpgaiaplsvvipahntglgpektsffqalsiptkiskgtieiindvhilkp
gdkvgaseatllnmlnispfsyg