PDB entry 6j2y

View 6j2y on RCSB PDB site
Description: Solution structure of translationally controlled tumor protein from photosynthetic microalga Nannochloropsis oceanica
Class: translation
Keywords: translation, TCTP, eEF1B-binding protein
Deposited on 2019-01-03, released 2019-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NoTCTP
  Species: Nannochloropsis oceanica [TaxId:145522]
  Database cross-references and differences (RAF-indexed):
  • PDB 6J2Y (0-187)
  Domains in SCOPe 2.08: d6j2ya1, d6j2ya2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6j2yA (A:)
  mivykdvisgdevvsdalkitpvmeggeevpglfevdsamvavgggdidigcgnafggag
  ddegaddatqkennvsgpssfaytampfsskgefkswvkdyvrnvrqalkgsgvavedik
  kfmeeaptfvkwlvdkyddleffmsksmnpdaglifsyykegahcptfvyvksgykvvkf
  lehhhhhh