PDB entry 6j1t

View 6j1t on RCSB PDB site
Description: Crystal structure of Candida Antarctica Lipase B mutant SR with product analogue
Class: hydrolase
Keywords: Calb, HYDROLASE
Deposited on 2018-12-29, released 2020-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipase b
    Species: Pseudozyma antarctica [TaxId:84753]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41365 (4-320)
      • expression tag (3)
      • engineered mutation (60)
      • engineered mutation (92)
      • engineered mutation (193)
      • engineered mutation (284-285)
    Domains in SCOPe 2.07: d6j1ta1, d6j1ta2
  • Chain 'B':
    Compound: lipase b
    Species: Pseudozyma antarctica [TaxId:84753]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41365 (4-320)
      • expression tag (3)
      • engineered mutation (60)
      • engineered mutation (92)
      • engineered mutation (193)
      • engineered mutation (284-285)
    Domains in SCOPe 2.07: d6j1tb1, d6j1tb2
  • Heterogens: B7U, SO4, PGE, EDO, CL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j1tA (A:)
    gamalpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwipls
    aqlgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltwsqgglvaqwglt
    ffpsirskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqi
    vpttnlysatdeicqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvv
    grsalrsttgqarsadygitdcnplpandltpeqkvaaaallapgvaaivagpkqncepd
    lmpyarpfavgkrtcsgivtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j1tA (A:)
    alpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaql
    gytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltwsqgglvaqwgltffp
    sirskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivpt
    tnlysatdeicqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrs
    alrsttgqarsadygitdcnplpandltpeqkvaaaallapgvaaivagpkqncepdlmp
    yarpfavgkrtcsgivtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6j1tB (B:)
    gamalpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwipls
    aqlgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltwsqgglvaqwglt
    ffpsirskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqi
    vpttnlysatdeicqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvv
    grsalrsttgqarsadygitdcnplpandltpeqkvaaaallapgvaaivagpkqncepd
    lmpyarpfavgkrtcsgivtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j1tB (B:)
    alpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaql
    gytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltwsqgglvaqwgltffp
    sirskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivpt
    tnlysatdeicqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrs
    alrsttgqarsadygitdcnplpandltpeqkvaaaallapgvaaivagpkqncepdlmp
    yarpfavgkrtcsgivtp