PDB entry 6j1r

View 6j1r on RCSB PDB site
Description: Crystal structure of Candida Antarctica Lipase B mutant - RR
Class: hydrolase
Keywords: calb, hydrolase
Deposited on 2018-12-29, released 2020-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipase b
    Species: Pseudozyma antarctica [TaxId:84753]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41365 (4-320)
      • expression tag (3)
      • engineered mutation (60)
      • engineered mutation (92)
      • engineered mutation (160)
      • engineered mutation (192)
    Domains in SCOPe 2.08: d6j1ra1, d6j1ra2
  • Chain 'B':
    Compound: lipase b
    Species: Pseudozyma antarctica [TaxId:84753]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41365 (4-320)
      • expression tag (2-3)
      • engineered mutation (60)
      • engineered mutation (92)
      • engineered mutation (160)
      • engineered mutation (192)
    Domains in SCOPe 2.08: d6j1rb1, d6j1rb2
  • Heterogens: SO4, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j1rA (A:)
    gamalpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwipls
    aqlgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltwsqgglvaqwglt
    ffpsirskvdrlmafapdykgtvlagpldalavsapsvwqlttgsalttalrnaggltqi
    vpttnlysatdeavqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvv
    grsalrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepd
    lmpyarpfavgkrtcsgivtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j1rA (A:)
    alpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaql
    gytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltwsqgglvaqwgltffp
    sirskvdrlmafapdykgtvlagpldalavsapsvwqlttgsalttalrnaggltqivpt
    tnlysatdeavqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrs
    alrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmp
    yarpfavgkrtcsgivtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6j1rB (B:)
    gamalpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwipls
    aqlgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltwsqgglvaqwglt
    ffpsirskvdrlmafapdykgtvlagpldalavsapsvwqlttgsalttalrnaggltqi
    vpttnlysatdeavqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvv
    grsalrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepd
    lmpyarpfavgkrtcsgivtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j1rB (B:)
    malpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaq
    lgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltwsqgglvaqwgltff
    psirskvdrlmafapdykgtvlagpldalavsapsvwqlttgsalttalrnaggltqivp
    ttnlysatdeavqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgr
    salrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlm
    pyarpfavgkrtcsgivtp