PDB entry 6j1i

View 6j1i on RCSB PDB site
Description: crystal structure of hypx from aquifex aeolicus, a392f-i419f variant
Deposited on 2018-12-28, released 2019-11-06
The last revision was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrogenase regulation HoxX
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: hoxX, aq_1156
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67224 (20-End)
      • expression tag (18-19)
      • engineered mutation (411)
      • engineered mutation (438)
  • Heterogens: COA, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6j1iA (A:)
    mgsshhhhhhssglvprgshmrilflsyrfnslsqrlycelterehevsveldvhpdltv
    eaaelykpdliiapflkrkipqevwkkyktliihpgppgdrgpnaldwaimkgeriwgvt
    lleaseeydagdvwayrtfpmrfarkasiyrnevtegvvecvlealenfergdfkptpqk
    ehwwnpkmeqelrrvdweqddtktvlrkvyasdsqpgasskvlgkevllfnaypeeelkg
    kpgevlalrdeavcigtrdgavwithmrerkkesiklpsarvlgeflkgvkedpikpwek
    vdfktyreilyeeedgigfihfnfyngamsteqcyrlletikyakkrpvkaivllgsedf
    fsngmnlntienaespadeswrninaiddvceeilktpdkltvagmqgnagfggvflalt
    cdlvfaregvvlnphyknfgnlygsefwtytlpkrvgwekgkevmenrmpisskkafeig
    lidgvfgktpkefrqrlkeriknfinskdfyefiekkkkertsgewleeiqkcrehelek
    mklnfygfdtsyhiaryyfvrrkphfrtppylaihrrlkfsl
    

    Sequence, based on observed residues (ATOM records):
    >6j1iA (A:)
    shmrilflsyrfnslsqrlycelterehevsveldvhpdltveaaelykpdliiapflkr
    kipqevwkkyktliihpgppgdrgpnaldwaimkgeriwgvtlleaseeydagdvwayrt
    fpmrfarkasiyrnevtegvvecvlealenfergdfkptpqkehwwnpkmeqelrrvdwe
    qddtktvlrkvyasdsqpgasskvlgkevllfnaypeeelkgkpgevlalrdeavcigtr
    dgavwithmrerkkesiklpsarvlgeflkgvkedpikpwekvdfktyreilyeeedgig
    fihfnfyngamsteqcyrlletikyakkrpvkaivllgsedffsngmnlntienaespad
    eswrninaiddvceeilktpdkltvagmqgnagfggvflaltcdlvfaregvvlnphykn
    fgnlygsefwtytlpkrvgwekgkevmenrmpisskkafeiglidgvfgktpkefrqrlk
    eriknfinskdfyefiekkkkertsgewleeiqkcrehelekmklnfygfdtsyhiaryy
    fvrrkphfrtppylaihrrlkfs