PDB entry 6j0k

View 6j0k on RCSB PDB site
Description: Crystal structure of intracellular B30.2 domain of BTN3A3 mutant in complex with HMBPP
Class: signaling protein
Keywords: Butyrophilin, SIGNALING PROTEIN
Deposited on 2018-12-24, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrophilin subfamily 3 member A3
    Species: Homo sapiens [TaxId:9606]
    Gene: BTN3A3, BTF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00478 (33-220)
      • expression tag (30-32)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d6j0ka1, d6j0ka2
  • Chain 'B':
    Compound: Butyrophilin subfamily 3 member A3
    Species: Homo sapiens [TaxId:9606]
    Gene: BTN3A3, BTF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00478 (33-220)
      • expression tag (30-32)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d6j0kb1, d6j0kb2
  • Heterogens: H6P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j0kA (A:)
    mgsshhhhhhssglvprgshmenlyfqgagagaayhewkmalfkpadvildpdtanaill
    vsedqrsvqraeeprdlpdnperfewhycvlgcenftsgrhywevevgdrkewhigvcsk
    nverkkgwvkmtpengywtmgltdgnkyralteprtnlklpepprkvgifldyetgeisf
    ynatdgshiytfphasfseplypvfriltleptalticpip
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j0kA (A:)
    agaayhewkmalfkpadvildpdtanaillvsedqrsvqraeeprdlpdnperfewhycv
    lgcenftsgrhywevevgdrkewhigvcsknverkkgwvkmtpengywtmgltdgnkyra
    lteprtnlklpepprkvgifldyetgeisfynatdgshiytfphasfseplypvfriltl
    eptalticpip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6j0kB (B:)
    mgsshhhhhhssglvprgshmenlyfqgagagaayhewkmalfkpadvildpdtanaill
    vsedqrsvqraeeprdlpdnperfewhycvlgcenftsgrhywevevgdrkewhigvcsk
    nverkkgwvkmtpengywtmgltdgnkyralteprtnlklpepprkvgifldyetgeisf
    ynatdgshiytfphasfseplypvfriltleptalticpip
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j0kB (B:)
    agaayhewkmalfkpadvildpdtanaillvsedqrsvqraeeprdlpdnperfewhycv
    lgcenftsgrhywevevgdrkewhigvcsknverkkgwvkmtpengywtmgltdgnkyra
    lteprtnlklpepprkvgifldyetgeisfynatdgshiytfphasfseplypvfriltl
    eptalticpip