PDB entry 6j0d

View 6j0d on RCSB PDB site
Description: crystal structure of ossuf4
Deposited on 2018-12-24, released 2019-11-06
The last revision was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MSE, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6j0dA (A:)
mgkkkkrvekvfcyycdrefddekilvqhqkakhfkchvchkklstaggmaihvlqvhke
svtkvpnakperesteieifgmqgippdvlaahyge

    Sequence, based on observed residues (ATOM records):
    >6j0dA (A:)
kvfcyycdrefddekilvqhqkakhfkchvchkklstaggmaihvlqvhkesvtkvpnak
peresteieifgmqgippdvlaahyge