PDB entry 6j07

View 6j07 on RCSB PDB site
Description: crystal structure of human terb2 and terb1
Deposited on 2018-12-21, released 2019-02-27
The last revision was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomere repeats-binding bouquet formation protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TERB2, C15orf43
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Telomere repeats-binding bouquet formation protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TERB1, CCDC79
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6j07A (A:)
gqrgwfcgsvsqdlrqfwvaeggtisdpraadflfscdashpdtlriyqsldyiednatv
fhayylsavanakiknsvalghfilppaclqkeirrkigsfiweqdq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6j07B (B:)
yrcsgciavekslnsrnfskllhscpyqcdrhkviveaedrykselrkslicnkkilltp