PDB entry 6j06

View 6j06 on RCSB PDB site
Description: Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with HMBPP-08
Class: signaling protein
Keywords: Butyrophilin, SIGNALING PROTEIN
Deposited on 2018-12-21, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTN3A1, BTF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00481 (2-187)
      • expression tag (1)
    Domains in SCOPe 2.07: d6j06a1, d6j06a2
  • Chain 'B':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTN3A1, BTF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00481 (2-187)
      • expression tag (1)
    Domains in SCOPe 2.07: d6j06b1, d6j06b2
  • Chain 'C':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTN3A1, BTF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00481 (2-187)
      • expression tag (1)
    Domains in SCOPe 2.07: d6j06c1, d6j06c2
  • Heterogens: 99C, SO4, FLC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j06A (A:)
    mgaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvl
    gcesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlt
    eprtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlep
    talticpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j06A (A:)
    gaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvlg
    cesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlte
    prtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlept
    alticpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6j06B (B:)
    mgaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvl
    gcesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlt
    eprtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlep
    talticpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j06B (B:)
    gaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvlg
    cesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlte
    prtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlept
    alticpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6j06C (C:)
    mgaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvl
    gcesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlt
    eprtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlep
    talticpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j06C (C:)
    gaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvlg
    cesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlte
    prtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlept
    alticpa