PDB entry 6j03

View 6j03 on RCSB PDB site
Description: crystal structure of a cyclase mutant in apo form
Deposited on 2018-12-20, released 2019-12-25
The last revision was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 12-epi-hapalindole U synthase
    Species: Fischerella ambigua UTEX 1903 [TaxId:230521]
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5TER4 (0-199)
      • engineered mutation (91)
      • engineered mutation (110)
  • Heterogens: 0HZ, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6j03A (A:)
savsipinnagfenpfmdvvddytidtppgwttydpnnlvpekrttwtsnngvgyvgpgt
qfynqlapegrnigyiylsqnpgsgvagfeqcldatlepdtkytltvdvgalagtfkgls
fagfpgyrvellagdtvlaadhnnlfikegefktstvtytstakdlhlgqklgirlvnll
qdkfsgldfdnvrlttepte