PDB entry 6izw

View 6izw on RCSB PDB site
Description: Myxococcus xanthus MglA bound to GTP-gamma-S and MglB
Class: signaling protein
Keywords: Small Ras-like GTPase, Cytosolic, Myxococcus motility protein, spatial oscillation, SIGNALING PROTEIN
Deposited on 2018-12-20, released 2019-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mutual gliding-motility protein MglA
  Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
  Gene: mglA, MXAN_1925
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q1DB04
• Chain 'B':
  Compound: Gliding motility protein MglB
  Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
  Gene: mglB, MXAN_1926
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q1DB03
    • engineered mutation (147)
• Chain 'C':
  Compound: Gliding motility protein MglB
  Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
  Gene: mglB, MXAN_1926
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q1DB03
  Domains in SCOPe 2.08: d6izwc_
• Heterogens: GSP, MG, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >6izwC (C:)
  mgtqlvmyeeeftkinavcdrltkdanakvvflvdkngqlissagqtqnidttslaslta
  gnvaamgglakligenefpnqfhegakdslymtivgsrvvlvvifdnrtslglvrlrikk
  asdeltkifeslvkktdspgagspfaemsdddidnlfsegshhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6izwC (C:)
  vmyeeeftkinavcdrltkdanakvvflvdkngqlissagqtqnidttslasltagnvaa
  mgglakligenefpnqfhegakdslymtivgsrvvlvvifdnrtslglvrlrikkasdel
  tkife