PDB entry 6izs

View 6izs on RCSB PDB site
Description: crystal structure of haemophilus influenzae bama potra4
Deposited on 2018-12-20, released 2019-10-30
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein assembly factor BamA
    Species: Haemophilus influenzae [TaxId:727]
    Gene: bamA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46024 (21-105)
      • expression tag (20)
      • expression tag (106)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6izsA (A:)
    mgsshhhhhhssglvprgshmlqydlrsariignlggmsaelepllsalhlndtfrrsdi
    advenaikaklgergygsatvnsvpdfddanktlaitlvvdagrrlgsgsgsgvaagvgy
    qw
    

    Sequence, based on observed residues (ATOM records):
    >6izsA (A:)
    mlqydlrsariignlggmsaelepllsalhlndtfrrsdiadvenaikaklgergygsat
    vnsvpdfddanktlaitlvvdagrrlg