PDB entry 6izg

View 6izg on RCSB PDB site
Description: Solution structure of Ufm1 protein from Trypanosoma brucei
Class: endocytosis
Keywords: Ubiquitin like protein, stress response protein, ENDOCYTOSIS
Deposited on 2018-12-19, released 2020-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-fold Modifier 1
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb927.8.5380
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6izga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6izgA (A:)
msqneeaparsggkvtfriiltsersqpfrvisiaeeapltaalrfaaeefgiasvdsma
attkdgtginpaqtagnvfmkygqeirliprdrvg