PDB entry 6iyh

View 6iyh on RCSB PDB site
Description: X-ray sequence and high resolution crystal structure of Persian sturgeon methemoglobin
Class: oxygen binding/transport protein
Keywords: methemoglobin, heme, iron containing, oxygen-carrying, OXYGEN BINDING-TRANSPORT PROTEIN complex
Deposited on 2018-12-16, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha chain
    Species: Acipenser persicus [TaxId:61968]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IYH (0-141)
    Domains in SCOPe 2.07: d6iyha_
  • Chain 'B':
    Compound: Beta chain
    Species: Acipenser persicus [TaxId:61968]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IYH (0-144)
    Domains in SCOPe 2.07: d6iyhb_
  • Heterogens: HEM, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6iyhA (A:)
sltsadkshvksiwskasgkaeelgaealgrmlevfpntktyfshyadlsvssgqvhthg
kkildaittavnhidditgtmtalstlhaktlrvdpanfkilshtilvvlalyfpadftp
evhlacdkflasvshtlatkyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6iyhB (B:)
ewtdserfaittlwakvnvesvgaqalvrllvvypwtqryfgafgnisdaaaiagnaqvh
ahgktvldsvgnaiahmddvadaftalstfhsetlhvdpdnfqhfgdclsivlaatfgta
ytpdvqaawqkmiaviisalskeyh