PDB entry 6iye

View 6iye on RCSB PDB site
Description: Crystal structure of peptidyl-tRNA hydrolase from Acinetobacter baumannii with 12% PEG 1500 at 1.55 A resolution.
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-12-15, released 2018-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
  Gene: pth, HMPREF0010_01329
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (3-195)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d6iyea1, d6iyea2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6iyeA (A:)
  gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
  hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
  lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
  gqvpqamnqinaykpa