PDB entry 6iy7

View 6iy7 on RCSB PDB site
Description: e. coli peptide deformylase crystal structure fitted into the cryo-em density map of e. coli 70s ribosome in complex with peptide deformylase
Deposited on 2018-12-13, released 2019-04-17
The last revision was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: Peptide deformylase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: def
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'P':
    Sequence, based on SEQRES records:
    >6iy7P (P:)
    msvlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriiv
    idvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfe
    leadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
    

    Sequence, based on observed residues (ATOM records):
    >6iy7P (P:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara