PDB entry 6iy4

View 6iy4 on RCSB PDB site
Description: Crystal structure of a psychrophilic marine protease MP inhibitor
Class: hydrolase inhibitor
Keywords: psychrophilic marine protease inhibitor, HYDROLASE INHIBITOR
Deposited on 2018-12-12, released 2019-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'I':
  Compound: LupI
  Species: Flavobacterium sp. YS-80-122 [TaxId:686394]
  Database cross-references and differences (RAF-indexed):
  • Uniprot G3MEU6 (0-92)
    • see sequence details (25)
  Domains in SCOPe 2.08: d6iy4i_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6iy4I (I:)
  lspaqvagswtfyvqgaeqdactvtlkkdrtfsaqvsclqawlgrtpttwsptpdgllli
  gkdgsqslflelreagryegsvegsktlvmqra