PDB entry 6ixy

View 6ixy on RCSB PDB site
Description: x-ray structure of major pilin from c. perfringens sm101
Deposited on 2018-12-12, released 2019-08-14
The last revision was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pilin
    Species: Clostridium perfringens (strain SM101 / Type A) [TaxId:289380]
    Gene: CPR_0145
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0SWL8 (17-End)
      • expression tag (16)
  • Chain 'B':
    Compound: Pilin
    Species: Clostridium perfringens (strain SM101 / Type A) [TaxId:289380]
    Gene: CPR_0145
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0SWL8 (17-End)
      • expression tag (16)
  • Chain 'C':
    Compound: Pilin
    Species: Clostridium perfringens (strain SM101 / Type A) [TaxId:289380]
    Gene: CPR_0145
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0SWL8 (17-End)
      • expression tag (16)
  • Chain 'D':
    Compound: Pilin
    Species: Clostridium perfringens (strain SM101 / Type A) [TaxId:289380]
    Gene: CPR_0145
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0SWL8 (17-End)
      • expression tag (16)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ixyA (A:)
    mnhkvhhhhhhiegrhmtpsiskdapikgsitiskkgatftayklldatksgdayeysvn
    sdlkdffnnsnygsysqesiqklsgeevkefavklhkyvldnkksgkeltdgqkntvdlg
    yylvteassdsegaavastpiivsvpqvsgdswnydvtinpkdntpileknivkenqrvk
    tssenigdvvkyevkasipvyqknaqdimykftdtmskgltydektgfkvtsgdkvfakd
    kdytvevkkqedgetvitinfvyenikayaetgitlnyqatlnkdvvisnkenlgntnni
    qldytnnphvkdsykkltdkvttytfgfgitkvdselnskllqgaefsvkdesgktvaky
    tydekgqvvslsgngvtnskgittfvglkegkyliteevapsgysllknpvevtitankd
    esgkytgaatieisngnkagqiindisendgnilfnvqienhagfslpstgglgnt
    

    Sequence, based on observed residues (ATOM records):
    >6ixyA (A:)
    mtpsiskdapikgsitiskkgatftayklldatksgdayeysvnsdlkdffnnsnygsys
    qesiqklsgeevkefavklhkyvldnkksgkeltdgqkntvdlgyylvteassdsegaav
    astpiivsvpqvsgdswnydvtinpkdntpileknivkenqrvktssenigdvvkyevka
    sipvyqknaqdimykftdtmskgltydektgfkvtsgdkvfakdkdytvevkkqedgetv
    itinfvyenikayaetgitlnyqatlnkdvvisnkenlgntnniqldytnnphvkdsykk
    ltdkvttytfgfgitkvdselnskllqgaefsvkdesgktvakytydekgqvvslsgngv
    tnskgittfvglkegkyliteevapsgysllknpvevtitankdesgkytgaatieisng
    nkagqiindisendgnilfnvqienhag
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ixyB (B:)
    mnhkvhhhhhhiegrhmtpsiskdapikgsitiskkgatftayklldatksgdayeysvn
    sdlkdffnnsnygsysqesiqklsgeevkefavklhkyvldnkksgkeltdgqkntvdlg
    yylvteassdsegaavastpiivsvpqvsgdswnydvtinpkdntpileknivkenqrvk
    tssenigdvvkyevkasipvyqknaqdimykftdtmskgltydektgfkvtsgdkvfakd
    kdytvevkkqedgetvitinfvyenikayaetgitlnyqatlnkdvvisnkenlgntnni
    qldytnnphvkdsykkltdkvttytfgfgitkvdselnskllqgaefsvkdesgktvaky
    tydekgqvvslsgngvtnskgittfvglkegkyliteevapsgysllknpvevtitankd
    esgkytgaatieisngnkagqiindisendgnilfnvqienhagfslpstgglgnt
    

    Sequence, based on observed residues (ATOM records):
    >6ixyB (B:)
    mtpsiskdapikgsitiskkgatftayklldatksgdayeysvnsdlkdffnnsnygsys
    qesiqklsgeevkefavklhkyvldnkksgkeltdgqkntvdlgyylvteassdsegaav
    astpiivsvpqvsgdswnydvtinpkdntpileknivkenqrvktssenigdvvkyevka
    sipvyqknaqdimykftdtmskgltydektgfkvtsgdkvfakdkdytvevkkqedgetv
    itinfvyenikayaetgitlnyqatlnkdvvisnkenlgntnniqldytnnphvkdsykk
    ltdkvttytfgfgitkvdselnskllqgaefsvkdesgktvakytydekgqvvslsgngv
    tnskgittfvglkegkyliteevapsgysllknpvevtitankdesgkytgaatieisng
    nkagqiindisendgnilfnvqienhagfslpst
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6ixyC (C:)
    mnhkvhhhhhhiegrhmtpsiskdapikgsitiskkgatftayklldatksgdayeysvn
    sdlkdffnnsnygsysqesiqklsgeevkefavklhkyvldnkksgkeltdgqkntvdlg
    yylvteassdsegaavastpiivsvpqvsgdswnydvtinpkdntpileknivkenqrvk
    tssenigdvvkyevkasipvyqknaqdimykftdtmskgltydektgfkvtsgdkvfakd
    kdytvevkkqedgetvitinfvyenikayaetgitlnyqatlnkdvvisnkenlgntnni
    qldytnnphvkdsykkltdkvttytfgfgitkvdselnskllqgaefsvkdesgktvaky
    tydekgqvvslsgngvtnskgittfvglkegkyliteevapsgysllknpvevtitankd
    esgkytgaatieisngnkagqiindisendgnilfnvqienhagfslpstgglgnt
    

    Sequence, based on observed residues (ATOM records):
    >6ixyC (C:)
    mtpsiskdapikgsitiskkgatftayklldatksgdayeysvnsdlkdffnnsnygsys
    qesiqklsgeevkefavklhkyvldnkksgkeltdgqkntvdlgyylvteassdsegaav
    astpiivsvpqvsgdswnydvtinpkdntpileknivkenqrvktssenigdvvkyevka
    sipvyqknaqdimykftdtmskgltydektgfkvtsgdkvfakdkdytvevkkqedgetv
    itinfvyenikayaetgitlnyqatlnkdvvisnkenlgntnniqldytnnphvkdsykk
    ltdkvttytfgfgitkvdselnskllqgaefsvkdesgktvakytydekgqvvslsgngv
    tnskgittfvglkegkyliteevapsgysllknpvevtitankdesgkytgaatieisng
    nkagqiindisendgnilfnvqienhag
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6ixyD (D:)
    mnhkvhhhhhhiegrhmtpsiskdapikgsitiskkgatftayklldatksgdayeysvn
    sdlkdffnnsnygsysqesiqklsgeevkefavklhkyvldnkksgkeltdgqkntvdlg
    yylvteassdsegaavastpiivsvpqvsgdswnydvtinpkdntpileknivkenqrvk
    tssenigdvvkyevkasipvyqknaqdimykftdtmskgltydektgfkvtsgdkvfakd
    kdytvevkkqedgetvitinfvyenikayaetgitlnyqatlnkdvvisnkenlgntnni
    qldytnnphvkdsykkltdkvttytfgfgitkvdselnskllqgaefsvkdesgktvaky
    tydekgqvvslsgngvtnskgittfvglkegkyliteevapsgysllknpvevtitankd
    esgkytgaatieisngnkagqiindisendgnilfnvqienhagfslpstgglgnt
    

    Sequence, based on observed residues (ATOM records):
    >6ixyD (D:)
    mtpsiskdapikgsitiskkgatftayklldatksgdayeysvnsdlkdffnnsnygsys
    qesiqklsgeevkefavklhkyvldnkksgkeltdgqkntvdlgyylvteassdsegaav
    astpiivsvpqvsgdswnydvtinpkdntpileknivkenqrvktssenigdvvkyevka
    sipvyqknaqdimykftdtmskgltydektgfkvtsgdkvfakdkdytvevkkqedgetv
    itinfvyenikayaetgitlnyqatlnkdvvisnkenlgntnniqldytnnphvkdsykk
    ltdkvttytfgfgitkvdselnskllqgaefsvkdesgktvakytydekgqvvslsgngv
    tnskgittfvglkegkyliteevapsgysllknpvevtitankdesgkytgaatieisng
    nkagqiindisendgnilfnvqienhagfslpst