PDB entry 6ixx

View 6ixx on RCSB PDB site
Description: Crystal structure of a complex between psychrophilic marine protease MP and its inhibitor LupI
Class: hydrolase/inihbitor
Keywords: psychrophilic marine protease, protein-protein complex, HYDROLASE-INIHBITOR complex
Deposited on 2018-12-12, released 2019-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline metalloprotease
    Species: Flavobacterium sp. YS-80-122 [TaxId:686394]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixxa1, d6ixxa2
  • Chain 'I':
    Compound: LupI
    Species: Flavobacterium sp. YS-80-122 [TaxId:686394]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G3MEU6 (0-96)
      • see sequence details (29)
    Domains in SCOPe 2.07: d6ixxi_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ixxA (A:)
    angtssaftqvdnfshfydrgnhlvngkpsftvdqaadqltrsgaswydlngdgvinlsy
    tfltspppgyasrglgtfssfsglqkeqaklsleswadvakvtftegpaargddghmtfa
    nfsasnggaafaylpnssrkgeswylinkdydvnktpgegnygrqtltheightlglshp
    gdynagngnpsyrdavygedtraysvmsywsekntgqvftktgegayasapllddiaavq
    klyganmetragdtvygfnstadrdyysatsatdklifsvwdgggndtldfsgfsqnqki
    nlaagsfsdvggmtgnvsiaqgvtienaiggsgndlllgnaasnilkggagndiiygggg
    adklwggsgsdtfvyrevsdstpkaadtlmdfqtgldkidltgithlsglnfvnaftgqa
    gdavvsynqasnagslqvdfsghgvadflittvgqvatydiva
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ixxI (I:)
    slmllspaqvagswtfyvqgaeqdactvtlkkdrtfsaqvsclqawlgrtpttwsptpdg
    llligkdgsqslflelreagryegsvegsktlvmqra