PDB entry 6iws

View 6iws on RCSB PDB site
Description: Solution structure of the J-domain of Tid1, a Mitochondrial Hsp40/DnaJ Protein
Class: chaperone
Keywords: Tid1, mtHsp40, DnaJA3, J-domain, Solution structure, HPD motif, CHAPERONE
Deposited on 2018-12-06, released 2019-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DnaJ homolog subfamily A member 3, mitochondrial
  Species: Homo sapiens [TaxId:9606]
  Gene: DNAJA3, HCA57, TID1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96EY1 (2-72)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d6iwsa1, d6iwsa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6iwsA (A:)
  hmlakedyyqilgvprnasqkeikkayyqlakkyhpdtnkddpkakekfsqlaeayevls
  devkrkqydaygs