PDB entry 6iwo

View 6iwo on RCSB PDB site
Description: Structural insight into probable lipid transfer mechanism of non-specific lipid transfer protein via intermediate structures in Solanum melongena
Class: lipid transport
Keywords: nsLTP, myristic acid, LIPID TRANSPORT
Deposited on 2018-12-05, released 2019-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-13, with a file datestamp of 2020-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-specific lipid-transfer protein
    Species: Solanum melongena [TaxId:4111]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6iwoa_
  • Chain 'B':
    Compound: Non-specific lipid-transfer protein
    Species: Solanum melongena [TaxId:4111]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6iwob_
  • Heterogens: MYR, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iwoA (A:)
    avtcgqvdanlapcvpfltqggepgaaccsgvktlngnaqspddrktacncikaaanryp
    nlkddaaqslpskcgislnvpisrtincdtis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6iwoB (B:)
    avtcgqvdanlapcvpfltqggepgaaccsgvktlngnaqspddrktacncikaaanryp
    nlkddaaqslpskcgislnvpisrtincdtis
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iwoB (B:)
    vtcgqvdanlapcvpfltqggepgaaccsgvktlngnaqspddrktacncikaaanrypn
    lkddaaqslpskcgislnvpisrtincdti