PDB entry 6ivv

View 6ivv on RCSB PDB site
Description: Structure of peptidyl-tRNA hydrolase from Acinetobacter baumannii with multiple surface binding regions at 1.26A resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-12-04, released 2018-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
    Gene: pth, HMPREF0010_01329
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0C9L6 (3-195)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d6ivva1, d6ivva2
  • Heterogens: CL, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ivvA (A:)
    gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
    hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
    lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
    gqvpqamnqinaykpa