PDB entry 6ivu

View 6ivu on RCSB PDB site
Description: solution structure of the sigma-anti-sigma factor complex rsgi1n- sigi1c from clostridium thermocellum
Deposited on 2018-12-04, released 2019-05-15
The last revision was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-sigma-I factor RsgI1
    Species: Hungateiclostridium thermocellum ATCC 27405 [TaxId:203119]
    Gene: Cthe_0059
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DBH1 (1-52)
      • expression tag (0)
  • Chain 'B':
    Compound: RNA polymerase sigma factor SigI1
    Species: Clostridium thermocellum [TaxId:203119]
    Gene: sigI1, Cthe_0058
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DBH0 (1-109)
      • initiating methionine (0)
      • expression tag (110-117)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ivuA (A:)
smnrlgiiyeiqgmkavvltsegefliirrrkdmkvgqqvsfenediynvrgk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6ivuB (B:)
mediearedieelkkklqefgitfldlvlnvpkhrdsrqlcirlakmlaedeqmynalmk
nkniprnelkkkakvhgrtignnrkyiialclifrsnlnlskryleyytmlehhhhhh