PDB entry 6ivh

View 6ivh on RCSB PDB site
Description: crystal structure of the n-terminal domain of scpa derived from thermococcus onnurineus
Deposited on 2018-12-04, released 2020-01-22
The last revision was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Segregation and condensation protein A
    Species: Thermococcus onnurineus (strain NA1) [TaxId:523850]
    Gene: TON_1071
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ivhA (A:)
mesrreeeitpvdillqlvqmgkvdpwnidivdltekyierlremkeldlrvsarailaa
silvrmkseallyadeedeeekheehirveveplapplrrveryytfddlldalmdalee
aekrkp

    Sequence, based on observed residues (ATOM records):
    >6ivhA (A:)
eeeitpvdillqlvqmgkvdpwnidivdltekyierlremkeldlrvsarailaasilvr
mkseallyaplrrveryytfddlldalmdaleea