PDB entry 6ive

View 6ive on RCSB PDB site
Description: Molecular structure of a thermostable and a Zinc ion binding gamma-class carbonic anhydrase
Class: metal binding protein
Keywords: Gamma-class carbonic anhydrase Metal binding protein, METAL BINDING PROTEIN
Deposited on 2018-12-03, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferripyochelin-binding protein
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: TTHA1879
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SH51 (Start-169)
      • expression tag (170)
    Domains in SCOPe 2.07: d6ivea1, d6ivea2
  • Chain 'B':
    Compound: Ferripyochelin-binding protein
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: TTHA1879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iveb_
  • Chain 'C':
    Compound: Ferripyochelin-binding protein
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: TTHA1879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ivec_
  • Chain 'D':
    Compound: Ferripyochelin-binding protein
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: TTHA1879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ived_
  • Chain 'E':
    Compound: Ferripyochelin-binding protein
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: TTHA1879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ivee_
  • Chain 'F':
    Compound: Ferripyochelin-binding protein
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: TTHA1879
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SH51 (Start-169)
      • expression tag (170)
    Domains in SCOPe 2.07: d6ivef1, d6ivef2
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iveA (A:)
    gsmsvyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnv
    qdgavlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgag
    avvppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpvat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iveA (A:)
    svyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnvqdg
    avlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgagavv
    ppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpvat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6iveB (B:)
    gsmsvyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnv
    qdgavlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgag
    avvppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpvat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iveB (B:)
    vyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnvqdga
    vlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgagavvp
    pgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6iveC (C:)
    gsmsvyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnv
    qdgavlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgag
    avvppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpvat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iveC (C:)
    msvyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnvqd
    gavlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgagav
    vppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6iveD (D:)
    gsmsvyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnv
    qdgavlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgag
    avvppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpvat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iveD (D:)
    msvyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnvqd
    gavlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgagav
    vppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6iveE (E:)
    gsmsvyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnv
    qdgavlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgag
    avvppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpvat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iveE (E:)
    svyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnvqdg
    avlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgagavv
    ppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpva
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6iveF (F:)
    gsmsvyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnv
    qdgavlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgag
    avvppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpvat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iveF (F:)
    svyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnvqdg
    avlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgagavv
    ppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpvat