PDB entry 6iv5

View 6iv5 on RCSB PDB site
Description: Crystal structure of arabidopsis N6-mAMP deaminase MAPDA
Class: hydrolase
Keywords: m6A, N6-mAMP, arabidopsis, Zn, HYDROLASE
Deposited on 2018-12-02, released 2019-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosine/AMP deaminase family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g04880, T4B21.20, T4B21_20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6iv5a_
  • Heterogens: PO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iv5A (A:)
    mewiqslpkielhahlngsirdstllelarvlgekgvivfadvehviqkndrslvevfkl
    fdlihklttdhktvtritrevvedfalenvvylelrttpkrsdsigmskrsymeaviqgl
    rsvsevdidfvtasdsqklhnagdgigrkkiyvrlllsidrrettesametvklalemrd
    vgvvgidlsgnplvgewstflpalqyakdndlhitlhcgevpnpkeiqamldfkphrigh
    acffkdedwtklksfripveicltsnivtksissidihhfadlynakhplilctddfgvf
    stslsneyalavrslglsksetfalaraaidatfaedevkqqlrfifdsaspehv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iv5A (A:)
    mewiqslpkielhahlngsirdstllelarvlgekgvivfadvehviqkndrslvevfkl
    fdlihklttdhktvtritrevvedfalenvvylelrttpkrsdsigmskrsymeaviqgl
    rsvsevdidfvrkkiyvrlllsidrrettesametvklalemrdvgvvgidlsgnplvge
    wstflpalqyakdndlhitlhcgevpnpkeiqamldfkphrighacffkdedwtklksfr
    ipveicltsnivtksissidihhfadlynakhplilctddfgvfstslsneyalavrslg
    lsksetfalaraaidatfaedevkqqlrfifdsa