PDB entry 6iuf

View 6iuf on RCSB PDB site
Description: crystal structure of anti-crispr protein acrva5
Deposited on 2018-11-28, released 2019-04-10
The last revision was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-a
    Species: Moraxella bovoculi [TaxId:386891]
    Gene: AAX07_09540
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: protein-a
    Species: Moraxella bovoculi [TaxId:386891]
    Gene: AAX07_09540
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACO, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6iufA (A:)
plgsmkielsggyicysieedevtidmvevttkrqgigsqlidmvkdvarevglpiglya
ypqddsisqedliefyfsndfeydpddvdgrlmrws

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6iufB (B:)
plgsmkielsggyicysieedevtidmvevttkrqgigsqlidmvkdvarevglpiglya
ypqddsisqedliefyfsndfeydpddvdgrlmrws

    Sequence, based on observed residues (ATOM records):
    >6iufB (B:)
lgsmkielsggyicysieedevtidmvevttkrqgigsqlidmvkdvarevglpiglyay
pqddsisqedliefyfsndfeydpddvdgrlmrws