PDB entry 6itu

View 6itu on RCSB PDB site
Description: crystal structure of the gulp1 ptb domain-app peptide complex
Deposited on 2018-11-26, released 2019-08-14
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTB domain-containing engulfment adapter protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GULP1, CED6, GULP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: amyloid beta a4 protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ITU (0-11)
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ituA (A:)
    mnrafsrkkdktwmhtpealskhfipynakflgsteveqpkgtevvrdavrklkfarhik
    ksegqkipkvelqisiygvkilepktkevqhncqlhrisfcaddktdkriftfickdses
    nkhlcyvfdsekcaeeitltigqafdlayrkflesggkdvetrkqiag
    

    Sequence, based on observed residues (ATOM records):
    >6ituA (A:)
    htpealskhfipynakflgsteveqpkgtevvrdavrklkfarhikksegqkipkvelqi
    siygvkilepktkevqhncqlhrisfcaddktdkriftfickdsesnkhlcyvfdsekca
    eeitltigqafdlayrkflesggkdv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6ituB (B:)
    ngyenptykffe